Recombinant Human FAAH, GST-tagged
| Cat.No. : | FAAH-26642TH |
| Product Overview : | Recombinant Human FAAH(480 a.a. - 579 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVAL PWQEELCLRFMREVERLMTPEKQSS |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80oC. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAAH fatty acid amide hydrolase [ Homo sapiens (human) ] |
| Official Symbol | FAAH |
| Synonyms | FAAH; fatty acid amide hydrolase; fatty-acid amide hydrolase 1; FAAH 1; oleamide hydrolase 1; anandamide amidohydrolase 1; FAAH-1; MGC102823; MGC138146 |
| Gene ID | 2166 |
| mRNA Refseq | NM_001441 |
| Protein Refseq | NP_001432 |
| MIM | 602935 |
| UniProt ID | O00519 |
| Chromosome Location | 1p35-p34 |
| Pathway | Retrograde endocannabinoid signaling; anandamide degradation |
| Function | acylglycerol lipase activity; carbon-nitrogen ligase activity, with glutamine as amido-N-donor; fatty acid amide hydrolase activity |
| ◆ Recombinant Proteins | ||
| RFL17615HF | Recombinant Full Length Human Fatty-Acid Amide Hydrolase 1(Faah) Protein, His-Tagged | +Inquiry |
| FAAH-12629H | Recombinant Human FAAH, GST-tagged | +Inquiry |
| Faah-1455M | Recombinant Mouse Faah Protein, His&GST-tagged | +Inquiry |
| RFL28695RF | Recombinant Full Length Rat Fatty-Acid Amide Hydrolase 1(Faah) Protein, His-Tagged | +Inquiry |
| Faah-1456R | Recombinant Rat Faah Protein, His&GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAAH Products
Required fields are marked with *
My Review for All FAAH Products
Required fields are marked with *
