"FAAH" Related Products

Expand
Expand
Expand

Recombinant Human FAAH, GST-tagged

Cat.No.: FAAH-26642TH
Product Overview: Recombinant Human FAAH(480 a.a. - 579 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.74 kDa
AA Sequence: DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVAL PWQEELCLRFMREVERLMTPEKQSS
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80oC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: FAAH fatty acid amide hydrolase [ Homo sapiens (human) ]
Official Symbol: FAAH
Synonyms: FAAH; fatty acid amide hydrolase; fatty-acid amide hydrolase 1; FAAH 1; oleamide hydrolase 1; anandamide amidohydrolase 1; FAAH-1; MGC102823; MGC138146
Gene ID: 2166
mRNA Refseq: NM_001441
Protein Refseq: NP_001432
MIM: 602935
UniProt ID: O00519
Chromosome Location: 1p35-p34
Pathway: Retrograde endocannabinoid signaling; anandamide degradation
Function: acylglycerol lipase activity; carbon-nitrogen ligase activity, with glutamine as amido-N-donor; fatty acid amide hydrolase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.