"FXR2" Related Products

Expand

Recombinant Human FXR2, His-tagged

Cat.No.: FXR2-26270TH
Product Overview: Recombinant fragment, corresponding to amino acids 217-512 of Human FXR2 with N terminal His tag; 296 amino acids, 34kDa.
Description: The protein encoded by this gene is a RNA binding protein containing two KH domains and one RCG box, which is similar to FMRP and FXR1. It associates with polyribosomes, predominantly with 60S large ribosomal subunits. This encoded protein may self-associate or interact with FMRP and FXR1. It may have a role in the development of fragile X mental retardation syndrome.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 117 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: KHLETSKQLAAAFQEEFTVREDLMGLAIGTHGANIQQARK VPGVTAIELGEETCTFRIYGETPEACRQARSYLEFSED SVQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDK KNPREEGMVPFIFVGTRENISNAQALLEYHLSYLQEVE QLRLERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYS TDESSSSSLHATRTYGGSYGGRGRGRRTGGPAYGPSSDVS TASETESEKREEPNRAGPGDRDPPTRGEESRRRPTGGR GRGPPPAPRPTSRYNSSSISSVLK
Sequence Similarities: Belongs to the FMR1 family.Contains 2 KH domains.
Gene Name: FXR2 fragile X mental retardation, autosomal homolog 2 [ Homo sapiens ]
Official Symbol: FXR2
Synonyms: FXR2; fragile X mental retardation, autosomal homolog 2; FMR1L2; fragile X mental retardation syndrome-related protein 2;
Gene ID: 9513
mRNA Refseq: NM_004860
Protein Refseq: NP_004851
MIM: 605339
Uniprot ID: P51116
Chromosome Location: 17p13.3
Pathway: RNA transport, organism-specific biosystem; RNA transport, conserved biosystem;
Function: RNA binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.