Recombinant Human FXR2, His-tagged
Cat.No. : | FXR2-26270TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 217-512 of Human FXR2 with N terminal His tag; 296 amino acids, 34kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a RNA binding protein containing two KH domains and one RCG box, which is similar to FMRP and FXR1. It associates with polyribosomes, predominantly with 60S large ribosomal subunits. This encoded protein may self-associate or interact with FMRP and FXR1. It may have a role in the development of fragile X mental retardation syndrome. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 117 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | KHLETSKQLAAAFQEEFTVREDLMGLAIGTHGANIQQARK VPGVTAIELGEETCTFRIYGETPEACRQARSYLEFSED SVQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDK KNPREEGMVPFIFVGTRENISNAQALLEYHLSYLQEVE QLRLERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYS TDESSSSSLHATRTYGGSYGGRGRGRRTGGPAYGPSSDVS TASETESEKREEPNRAGPGDRDPPTRGEESRRRPTGGR GRGPPPAPRPTSRYNSSSISSVLK |
Sequence Similarities : | Belongs to the FMR1 family.Contains 2 KH domains. |
Gene Name : | FXR2 fragile X mental retardation, autosomal homolog 2 [ Homo sapiens ] |
Official Symbol : | FXR2 |
Synonyms : | FXR2; fragile X mental retardation, autosomal homolog 2; FMR1L2; fragile X mental retardation syndrome-related protein 2; |
Gene ID : | 9513 |
mRNA Refseq : | NM_004860 |
Protein Refseq : | NP_004851 |
MIM : | 605339 |
Uniprot ID : | P51116 |
Chromosome Location : | 17p13.3 |
Pathway : | RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; |
Function : | RNA binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
FXR2-2989H | Recombinant Human FXR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FXR2-1593R | Recombinant Rhesus Macaque FXR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FXR2-4578H | Recombinant Human FXR2 Protein, GST-tagged | +Inquiry |
FXR2-748H | Recombinant Human FXR2 | +Inquiry |
FXR2-13053H | Recombinant Human FXR2, His-tagged | +Inquiry |
◆ Lysates | ||
FXR2-677HCL | Recombinant Human FXR2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket