Recombinant Human GATM GATM-28986TH

Recombinant Human GATM

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GATM

Recombinant Human GATM

GATM Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GATM-28986TH
Product Overview : Recombinant fragment of Human GATM with an N-terminal proprietary tag; Predicted MW 36.63kDa.
Description : This gene encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.
Protein length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in brain, heart, kidney, liver, lung, salivary gland and skeletal muscle tissue, with the highest expression in kidney. Biallelically expressed in placenta and fetal tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQ AATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIV GRAENACVPPFTIEVKANTY
Sequence Similarities : Belongs to the amidinotransferase family.
Gene Name : GATM glycine amidinotransferase (L-arginine:glycine amidinotransferase) [ Homo sapiens ]
Official Symbol : GATM
Synonyms : GATM; glycine amidinotransferase (L-arginine:glycine amidinotransferase); glycine amidinotransferase, mitochondrial; AGAT;
Gene ID : 2628
mRNA Refseq : NM_001482
Protein Refseq : NP_001473
MIM : 602360
Uniprot ID : P50440
Chromosome Location : 15q15.1
Pathway : Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem;
Function : glycine amidinotransferase activity; glycine amidinotransferase activity; transferase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy