Recombinant Human GCG

Cat.No. : GCG-30529TH
Product Overview : Recombinant fragment human Oxyntomodulin is a single, non-glycosylated polypeptide chain containing 37 amino acids and having a molecular mass of4kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Form : Lyophilised:Reconstitute in 20mM acetic acid.
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: None
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Gene Name GCG glucagon [ Homo sapiens ]
Official Symbol GCG
Synonyms GCG; glucagon; glicentin related polypeptide; GLP1; GLP2; glucagon like peptide 1; glucagon like peptide 2; GRPP;
Gene ID 2641
mRNA Refseq NM_002054
Protein Refseq NP_002045
MIM 138030
Uniprot ID P01275
Chromosome Location 2q36-q37
Pathway Class B/2 (Secretin family receptors), organism-specific biosystem; Diabetes pathways, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem;
Function glucagon receptor binding; hormone activity; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GCG Products

Required fields are marked with *

My Review for All GCG Products

Required fields are marked with *

0
cart-icon