Recombinant Human GFM1, His-tagged
Cat.No. : | GFM1-28742TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 532-751 of Human GFM1 with N terminal His tag; Predicted MWt 25 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of the mitochondrial translation elongation factors. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 55 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PVPFDFTHKKQSGGAGQYGKVIGVLEPLDPEDYTKLEFSD ETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRF VLQDGAHHMVDSNEISFIRAGEGALKQALANATLCILE PIMAVEVVAPNEFQGQVIAGINRRHGVITGQDGVEDYF TLYADVPLNDMFGYSTELRSCTEGKGEYTMEYSRYQPCLP STQEDVINKYLEATGQLPVKKGKAKN |
Gene Name : | GFM1 G elongation factor, mitochondrial 1 [ Homo sapiens ] |
Official Symbol : | GFM1 |
Synonyms : | GFM1; G elongation factor, mitochondrial 1; G translation elongation factor, mitochondrial; elongation factor G, mitochondrial; EFGM; EGF1; GFM; |
Gene ID : | 85476 |
mRNA Refseq : | NM_024996 |
Protein Refseq : | NP_079272 |
MIM : | 606639 |
Uniprot ID : | Q96RP9 |
Chromosome Location : | 3q25 |
Function : | GTP binding; GTPase activity; nucleotide binding; translation elongation factor activity; translation elongation factor activity; |
Products Types
◆ Recombinant Protein | ||
Gfm1-3192M | Recombinant Mouse Gfm1 Protein, Myc/DDK-tagged | +Inquiry |
GFM1-4852H | Recombinant Human GFM1 Protein, GST-tagged | +Inquiry |
GFM1-3537M | Recombinant Mouse GFM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GFM1-977H | Recombinant Human GFM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GFM1-2167R | Recombinant Rat GFM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket