"GFM1" Related Products

Expand

Recombinant Human GFM1, His-tagged

Cat.No.: GFM1-28742TH
Product Overview: Recombinant fragment, corresponding to amino acids 532-751 of Human GFM1 with N terminal His tag; Predicted MWt 25 kDa.
Description: Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of the mitochondrial translation elongation factors. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 55 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PVPFDFTHKKQSGGAGQYGKVIGVLEPLDPEDYTKLEFSD ETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRF VLQDGAHHMVDSNEISFIRAGEGALKQALANATLCILE PIMAVEVVAPNEFQGQVIAGINRRHGVITGQDGVEDYF TLYADVPLNDMFGYSTELRSCTEGKGEYTMEYSRYQPCLP STQEDVINKYLEATGQLPVKKGKAKN
Gene Name: GFM1 G elongation factor, mitochondrial 1 [ Homo sapiens ]
Official Symbol: GFM1
Synonyms: GFM1; G elongation factor, mitochondrial 1; G translation elongation factor, mitochondrial; elongation factor G, mitochondrial; EFGM; EGF1; GFM;
Gene ID: 85476
mRNA Refseq: NM_024996
Protein Refseq: NP_079272
MIM: 606639
Uniprot ID: Q96RP9
Chromosome Location: 3q25
Function: GTP binding; GTPase activity; nucleotide binding; translation elongation factor activity; translation elongation factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.