Recombinant Human GOLGA2, His-tagged
Cat.No. : | GOLGA2-29029TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 318-617 of Human GM130 with N terminal His tag; 300 amino acids, 63kDa. GenBank: EAW87765.1 |
- Specification
- Gene Information
- Related Products
Description : | The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 121 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | LGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHL QQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQG KAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGE GDGLDREEEEDEEEEEEEAVAVPQPMPSIPEDLESREA MVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLA SAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFM ELMQEKADLKERAREGSPRDNPTAQQIMQLLREMQNPR ERPGLGSNPCIPFFYRADENDEVKITVI |
Sequence Similarities : | Belongs to the GOLGA2 family. |
Gene Name : | GOLGA2 golgin A2 [ Homo sapiens ] |
Official Symbol : | GOLGA2 |
Synonyms : | GOLGA2; golgin A2; golgi autoantigen, golgin subfamily a, 2; Golgin subfamily A member 2; GM130; Golgi matrix protein GM130; golgin 95; SY11 protein; |
Gene ID : | 2801 |
mRNA Refseq : | NM_004486 |
Protein Refseq : | NP_004477 |
MIM : | 602580 |
Uniprot ID : | Q08379 |
Chromosome Location : | 9q34.13 |
Pathway : | PLK1 signaling events, organism-specific biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
GOLGA2-5105H | Recombinant Human GOLGA2 Protein, GST-tagged | +Inquiry |
GOLGA2-01H | Recombinant Human GOLGA2 Protein, GST-tagged | +Inquiry |
GOLGA2-3291H | Recombinant Human GOLGA2 Protein (Ala361-Ala678), N-His tagged | +Inquiry |
GOLGA2-6782Z | Recombinant Zebrafish GOLGA2 | +Inquiry |
◆ Lysates | ||
GOLGA2-726HCL | Recombinant Human GOLGA2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionGOLGA2 protein is involved in regulating vesicular transport and protein trafficking within the cell, contributing to cellular signaling pathways.
Monitoring GOLGA2 protein levels may provide insights into disease progression and treatment response in certain clinical conditions.
Some genetic mutations in the GOLGA2 gene have been linked to developmental disorders and neurodevelopmental conditions.
The expression and activity of GOLGA2 protein are regulated by various cellular mechanisms, including post-translational modifications and protein-protein interactions.
GOLGA2 protein has been implicated in drug resistance mechanisms, and its overexpression may contribute to resistance to certain anticancer drugs.
Customer Reviews (3)
Write a reviewIts remarkable purity and functional attributes make it an optimal choice for my research, ensuring accurate and reliable outcomes.
The manufacturer's prompt and reliable technical support serves as an invaluable resource, reinforcing my confidence in the GOLGA2 protein's effectiveness and enabling smooth progress in my experiments.
I am eager to embark on this scientific journey, empowered by the high-quality GOLGA2 protein and the manufacturer's unparalleled assistance.
Ask a Question for All GOLGA2 Products
Required fields are marked with *
My Review for All GOLGA2 Products
Required fields are marked with *
Inquiry Basket