Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human GOLGA2, His-tagged

Cat.No. : GOLGA2-29029TH
Product Overview : Recombinant fragment, corresponding to amino acids 318-617 of Human GM130 with N terminal His tag; 300 amino acids, 63kDa. GenBank: EAW87765.1
  • Specification
  • Gene Information
  • Related Products
Description : The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 121 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : LGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHL QQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQG KAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGE GDGLDREEEEDEEEEEEEAVAVPQPMPSIPEDLESREA MVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLA SAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFM ELMQEKADLKERAREGSPRDNPTAQQIMQLLREMQNPR ERPGLGSNPCIPFFYRADENDEVKITVI
Sequence Similarities : Belongs to the GOLGA2 family.
Gene Name : GOLGA2 golgin A2 [ Homo sapiens ]
Official Symbol : GOLGA2
Synonyms : GOLGA2; golgin A2; golgi autoantigen, golgin subfamily a, 2; Golgin subfamily A member 2; GM130; Golgi matrix protein GM130; golgin 95; SY11 protein;
Gene ID : 2801
mRNA Refseq : NM_004486
Protein Refseq : NP_004477
MIM : 602580
Uniprot ID : Q08379
Chromosome Location : 9q34.13
Pathway : PLK1 signaling events, organism-specific biosystem;
Function : protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
How does GOLGA2 protein contribute to cellular transport and signaling? 11/19/2022

GOLGA2 protein is involved in regulating vesicular transport and protein trafficking within the cell, contributing to cellular signaling pathways.

Can GOLGA2 protein levels be used to monitor disease progression or treatment response? 10/27/2022

Monitoring GOLGA2 protein levels may provide insights into disease progression and treatment response in certain clinical conditions.

Are there any genetic mutations associated with GOLGA2 protein and clinical conditions? 06/22/2019

Some genetic mutations in the GOLGA2 gene have been linked to developmental disorders and neurodevelopmental conditions.

How is GOLGA2 protein regulated in the cell? 06/09/2019

The expression and activity of GOLGA2 protein are regulated by various cellular mechanisms, including post-translational modifications and protein-protein interactions.

How does GOLGA2 protein influence drug resistance in cancer? 12/21/2018

GOLGA2 protein has been implicated in drug resistance mechanisms, and its overexpression may contribute to resistance to certain anticancer drugs.

Customer Reviews (3)

Write a review
Reviews
05/31/2022

    Its remarkable purity and functional attributes make it an optimal choice for my research, ensuring accurate and reliable outcomes.

    06/06/2019

      The manufacturer's prompt and reliable technical support serves as an invaluable resource, reinforcing my confidence in the GOLGA2 protein's effectiveness and enabling smooth progress in my experiments.

      05/30/2016

        I am eager to embark on this scientific journey, empowered by the high-quality GOLGA2 protein and the manufacturer's unparalleled assistance.

        Ask a Question for All GOLGA2 Products

        Required fields are marked with *

        My Review for All GOLGA2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends