Recombinant Human GPR125, His-tagged
Cat.No. : | GPR125-29094TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1040-1321 of Human GPCR GPR125 with an N terminal His tag. Predicted mwt: 32 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1040-1321 a.a. |
Description : | GPR125 is an orphan receptor which has a leucine rich repeat (LRR),an immunoglobulin (Ig) domain, and a hormone-binding domain (HBD). The Ig domain shows similarities to motilin andtitin, while the LRR domain shows similarities to LRIG1 and SLIT1-2. ESTs have been isolated primarily from amnion,connective tissue, ear, embryo, eye,ganglion, heart, lung,placenta, and skin libraries. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 119 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AFFVVHHCVNREDVRLAWIMTCCPGRSSYSVQVNVQPPNS NGTNGEAPKCPNSSAESSCTNKSASSFKNSSQGCKLTN LQAAAAQCHANSLPLNSTPQLDNSLTEHSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREYAYDVP TSVEGSVQNGLPKSRLGNNEGHSRSRRAYLAYRERQYN PPQQDSSDACSTLPKSSRNFEKPVSTTSKKDALRKPAVVE LENQQKSYGLNLAIQNGPIKSNGQEGPLLGTDSTGNVR TGLWKHETTV |
Gene Name | GPR125 G protein-coupled receptor 125 [ Homo sapiens ] |
Official Symbol | GPR125 |
Synonyms | GPR125; G protein-coupled receptor 125; probable G-protein coupled receptor 125; FLJ38547; PGR21; |
Gene ID | 166647 |
mRNA Refseq | NM_145290 |
Protein Refseq | NP_660333 |
MIM | 612303 |
Uniprot ID | Q8IWK6 |
Chromosome Location | 4p15.31 |
Function | G-protein coupled receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
GPR125-3845M | Recombinant Mouse GPR125 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR125-7136M | Recombinant Mouse GPR125 Protein | +Inquiry |
GPR125-29094TH | Recombinant Human GPR125, His-tagged | +Inquiry |
GPR125-8478Z | Recombinant Zebrafish GPR125 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR125 Products
Required fields are marked with *
My Review for All GPR125 Products
Required fields are marked with *