Recombinant Human GPR125, His-tagged GPR125-29094TH

Recombinant Human GPR125, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GPR125, His-tagged

Recombinant Human GPR125, His-tagged

GPR125 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GPR125-29094TH
Product Overview : Recombinant fragment, corresponding to amino acids 1040-1321 of Human GPCR GPR125 with an N terminal His tag. Predicted mwt: 32 kDa;
Description : GPR125 is an orphan receptor which has a leucine rich repeat (LRR),an immunoglobulin (Ig) domain, and a hormone-binding domain (HBD). The Ig domain shows similarities to motilin andtitin, while the LRR domain shows similarities to LRIG1 and SLIT1-2. ESTs have been isolated primarily from amnion,connective tissue, ear, embryo, eye,ganglion, heart, lung,placenta, and skin libraries.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 119 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AFFVVHHCVNREDVRLAWIMTCCPGRSSYSVQVNVQPPNS NGTNGEAPKCPNSSAESSCTNKSASSFKNSSQGCKLTN LQAAAAQCHANSLPLNSTPQLDNSLTEHSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREYAYDVP TSVEGSVQNGLPKSRLGNNEGHSRSRRAYLAYRERQYN PPQQDSSDACSTLPKSSRNFEKPVSTTSKKDALRKPAVVE LENQQKSYGLNLAIQNGPIKSNGQEGPLLGTDSTGNVR TGLWKHETTV
Gene Name : GPR125 G protein-coupled receptor 125 [ Homo sapiens ]
Official Symbol : GPR125
Synonyms : GPR125; G protein-coupled receptor 125; probable G-protein coupled receptor 125; FLJ38547; PGR21;
Gene ID : 166647
mRNA Refseq : NM_145290
Protein Refseq : NP_660333
MIM : 612303
Uniprot ID : Q8IWK6
Chromosome Location : 4p15.31
Function : G-protein coupled receptor activity; receptor activity; signal transducer activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy