"GRAP2" Related Products

Expand
Expand
Expand

Recombinant Human GRAP2, His-tagged

Cat.No.: GRAP2-27308TH
Product Overview: Recombinant full length Human GRAP2 with an N terminal His tag; 350 amino acids with tag, MWt 40.0 kDa.
Description: This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist.
Protein length: 330 amino acids
Conjugation: HIS
Molecular Weight: 40.000kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Sequence Similarities: Belongs to the GRB2/sem-5/DRK family.Contains 1 SH2 domain.Contains 2 SH3 domains.
Gene Name: GRAP2 GRB2-related adaptor protein 2 [ Homo sapiens ]
Official Symbol: GRAP2
Synonyms: GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona;
Gene ID: 9402
mRNA Refseq: NM_004810
Protein Refseq: NP_004801
MIM: 604518
Uniprot ID: O75791
Chromosome Location: 22q13.2
Pathway: Adaptive Immune System, organism-specific biosystem; CD28 co-stimulation, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Generation of second messenger molecules, organism-specific biosystem; Immune System, organism-specific biosystem;
Function: SH3/SH2 adaptor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.