Recombinant Human GRAP2, His-tagged

Cat.No. : GRAP2-27308TH
Product Overview : Recombinant full length Human GRAP2 with an N terminal His tag; 350 amino acids with tag, MWt 40.0 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 330 amino acids
Description : This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist.
Conjugation : HIS
Molecular Weight : 40.000kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Sequence Similarities : Belongs to the GRB2/sem-5/DRK family.Contains 1 SH2 domain.Contains 2 SH3 domains.
Gene Name GRAP2 GRB2-related adaptor protein 2 [ Homo sapiens ]
Official Symbol GRAP2
Synonyms GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona;
Gene ID 9402
mRNA Refseq NM_004810
Protein Refseq NP_004801
MIM 604518
Uniprot ID O75791
Chromosome Location 22q13.2
Pathway Adaptive Immune System, organism-specific biosystem; CD28 co-stimulation, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Generation of second messenger molecules, organism-specific biosystem; Immune System, organism-specific biosystem;
Function SH3/SH2 adaptor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRAP2 Products

Required fields are marked with *

My Review for All GRAP2 Products

Required fields are marked with *

0
cart-icon