"HELLS" Related Products

Expand
Expand

Recombinant Human HELLS

Cat.No.: HELLS-31195TH
Product Overview: Recombinant full length Human SMARCA6 with N-terminal proprietary tag. Predicted MW 64.39kDa.
Description: This gene encodes a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Protein length: 348 amino acids
Molecular Weight: 64.390kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in proliferative tissues such as adult thymus and testis, and expressed at lower levels in uterus, small intestine, colon, and peripheral blood mononuclear cells. Also expressed in neoplastic cell lines including those derived from myeloi
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEK LISQIQPEVDRERAVVEVNIPVESEVNLKLQNIMMLLRKC CNHPYLIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPE LKKRGHKVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMS YSEREKNMHSFNTDPEVFIFLVSTRAGGLGINLTAADTVI IYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQ KIVERAAAKRKLEKLIIHKNHFKGGQSGLNLSKNFLDPKE LMELLKSRDYEREIKGSREKVISDKDLELLLDRSDLIDQM NASGPIKEKMGIFKILENSEDSSPECLF
Sequence Similarities: Belongs to the SNF2/RAD54 helicase family.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Gene Name: HELLS helicase, lymphoid-specific [ Homo sapiens ]
Official Symbol: HELLS
Synonyms: HELLS; helicase, lymphoid-specific; lymphoid-specific helicase; LSH; Nbla10143; PASG; proliferation associated SNF2 like protein; SMARCA6; SWI/SNF2 related; matrix associated; actin dependent regulator of chromatin; subfamily A; member 6;
Gene ID: 3070
mRNA Refseq: NM_018063
Protein Refseq: NP_060533
MIM: 603946
Uniprot ID: Q9NRZ9
Chromosome Location: 10q24.2
Pathway: Apoptosis, organism-specific biosystem;
Function: ATP binding; DNA binding; chromatin binding; helicase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.