Recombinant Human HELLS
Cat.No. : | HELLS-31195TH |
Product Overview : | Recombinant full length Human SMARCA6 with N-terminal proprietary tag. Predicted MW 64.39kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Protein length : | 348 amino acids |
Molecular Weight : | 64.390kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Highly expressed in proliferative tissues such as adult thymus and testis, and expressed at lower levels in uterus, small intestine, colon, and peripheral blood mononuclear cells. Also expressed in neoplastic cell lines including those derived from myeloi |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEK LISQIQPEVDRERAVVEVNIPVESEVNLKLQNIMMLLRKC CNHPYLIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPE LKKRGHKVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMS YSEREKNMHSFNTDPEVFIFLVSTRAGGLGINLTAADTVI IYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQ KIVERAAAKRKLEKLIIHKNHFKGGQSGLNLSKNFLDPKE LMELLKSRDYEREIKGSREKVISDKDLELLLDRSDLIDQM NASGPIKEKMGIFKILENSEDSSPECLF |
Sequence Similarities : | Belongs to the SNF2/RAD54 helicase family.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain. |
Gene Name : | HELLS helicase, lymphoid-specific [ Homo sapiens ] |
Official Symbol : | HELLS |
Synonyms : | HELLS; helicase, lymphoid-specific; lymphoid-specific helicase; LSH; Nbla10143; PASG; proliferation associated SNF2 like protein; SMARCA6; SWI/SNF2 related; matrix associated; actin dependent regulator of chromatin; subfamily A; member 6; |
Gene ID : | 3070 |
mRNA Refseq : | NM_018063 |
Protein Refseq : | NP_060533 |
MIM : | 603946 |
Uniprot ID : | Q9NRZ9 |
Chromosome Location : | 10q24.2 |
Pathway : | Apoptosis, organism-specific biosystem; |
Function : | ATP binding; DNA binding; chromatin binding; helicase activity; hydrolase activity; |
Products Types
◆ Recombinant Protein | ||
HELLS-4683H | Recombinant Human HELLS Protein, GST-tagged | +Inquiry |
Hells-1109M | Recombinant Mouse Hells Protein, MYC/DDK-tagged | +Inquiry |
HELLS-1885R | Recombinant Rhesus Macaque HELLS Protein, His (Fc)-Avi-tagged | +Inquiry |
HELLS-4117M | Recombinant Mouse HELLS Protein, His (Fc)-Avi-tagged | +Inquiry |
HELLS-2064R | Recombinant Rhesus monkey HELLS Protein, His-tagged | +Inquiry |
◆ Lysates | ||
HELLS-5589HCL | Recombinant Human HELLS 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket