Recombinant Human HPCAL1, His-tagged
Cat.No. : | HPCAL1-30156TH |
Product Overview : | Recombinant full length Human VILIP3 with an N terminal His tag; 213 amino acids with a predicted MWt 24.4kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 193 amino acids |
Description : | The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. There are two alternatively spliced transcript variants of this gene, with multiple polyadenylation sites. |
Conjugation : | HIS |
Molecular Weight : | 24.400kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF |
Gene Name | HPCAL1 hippocalcin-like 1 [ Homo sapiens ] |
Official Symbol | HPCAL1 |
Synonyms | HPCAL1; hippocalcin-like 1; hippocalcin-like protein 1; BDR1; calcium binding protein BDR 1; HLP2; VILIP 3; visinin like protein 3; |
Gene ID | 3241 |
mRNA Refseq | NM_002149 |
Protein Refseq | NP_002140 |
MIM | 600207 |
Uniprot ID | P37235 |
Chromosome Location | 2p25.1 |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
HPCAL1-5004H | Recombinant Human HPCAL1 Protein, GST-tagged | +Inquiry |
HPCAL1-3619HF | Recombinant Full Length Human HPCAL1 Protein, GST-tagged | +Inquiry |
HPCAL1-2137R | Recombinant Rhesus monkey HPCAL1 Protein, His-tagged | +Inquiry |
HPCAL1-1448H | Recombinant Human HPCAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HPCAL1-30156TH | Recombinant Human HPCAL1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPCAL1-5406HCL | Recombinant Human HPCAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPCAL1 Products
Required fields are marked with *
My Review for All HPCAL1 Products
Required fields are marked with *