"HPCAL1" Related Products

Expand
Expand

Recombinant Human HPCAL1, His-tagged

Cat.No.: HPCAL1-30156TH
Product Overview: Recombinant full length Human VILIP3 with an N terminal His tag; 213 amino acids with a predicted MWt 24.4kDa including tag.
Description: The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. There are two alternatively spliced transcript variants of this gene, with multiple polyadenylation sites.
Protein length: 193 amino acids
Conjugation: HIS
Molecular Weight: 24.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
Gene Name: HPCAL1 hippocalcin-like 1 [ Homo sapiens ]
Official Symbol: HPCAL1
Synonyms: HPCAL1; hippocalcin-like 1; hippocalcin-like protein 1; BDR1; calcium binding protein BDR 1; HLP2; VILIP 3; visinin like protein 3;
Gene ID: 3241
mRNA Refseq: NM_002149
Protein Refseq: NP_002140
MIM: 600207
Uniprot ID: P37235
Chromosome Location: 2p25.1
Function: calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.