"MAPKAP1" Related Products

Expand

Recombinant Human MAPKAP1, His-tagged

Cat.No.: MAPKAP1-29583TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-330 of Human SIN1 with N terminal His tag, 55kDa.
Description: This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3 UTRs have been identified for transcripts of this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitously expressed, with highest levels in heart and skeletal muscle.
Form: Lyophilised:Reconstitute with 78 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCL HIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSS PGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWE FCLVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSF KVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIK QKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYK HLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQ RKLNRRTSFSFQKEKKSGQQ
Sequence Similarities: Belongs to the SIN1 family.
Gene Name: MAPKAP1 mitogen-activated protein kinase associated protein 1 [ Homo sapiens ]
Official Symbol: MAPKAP1
Synonyms: MAPKAP1; mitogen-activated protein kinase associated protein 1; target of rapamycin complex 2 subunit MAPKAP1; MGC2745; MIP1; SIN1; stress activated protein kinase interacting 1;
Gene ID: 79109
mRNA Refseq: NM_001006617
Protein Refseq: NP_001006618
MIM: 610558
Uniprot ID: Q9BPZ7
Chromosome Location: 9q34.11
Pathway: Adaptive Immune System, organism-specific biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem; CXCR3-mediated signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem;
Function: Ras GTPase binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.