"MSMB" Related Products

Expand
Expand
Expand

Recombinant Human MSMB

Cat.No.: MSMB-31099TH
Product Overview: Recombinant full length Human Prostate Secretory Protein/PSP with N terminal proprietary tag, 38.65kDa.
Description: The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene.
Protein length: 114 amino acids
Molecular Weight: 38.650kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney an
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMD LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYD KDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Sequence Similarities: Belongs to the beta-microseminoprotein family.
Gene Name: MSMB microseminoprotein, beta- [ Homo sapiens ]
Official Symbol: MSMB
Synonyms: MSMB; microseminoprotein, beta-; beta-microseminoprotein; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP 94; PSP57; PSP94;
Gene ID: 4477
mRNA Refseq: NM_002443
Protein Refseq: NP_002434
MIM: 157145
Uniprot ID: P08118
Chromosome Location: 10q11.2
Function: molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.