Recombinant Human MSMB

• Cat.No.: MSMB-31099TH
• Product Overview: Recombinant full length Human Prostate Secretory Protein/PSP with N terminal proprietary tag, 38.65kDa.

Specification

• Description: The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene.
• Protein length: 114 amino acids
• Molecular Weight: 38.650kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney an
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMD LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYD KDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
• Sequence Similarities: Belongs to the beta-microseminoprotein family.

Gene Information

• Gene Name: MSMB microseminoprotein, beta- [ Homo sapiens ]
• Official Symbol: MSMB
• Synonyms: MSMB; microseminoprotein, beta-; beta-microseminoprotein; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP 94; PSP57; PSP94
• Gene ID: 4477
• mRNA Refseq: NM_002443
• Protein Refseq: NP_002434
• MIM: 157145
• Uniprot ID: P08118
• Chromosome Location: 10q11.2
• Function: molecular_function