| Species : | Human | 
                                
                                    | Source : | E.coli | 
                                
                                    | Tag : | His | 
                                
                                    | Protein Length : | 1-165 a.a. | 
                                
                                    | Description : | The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants. | 
                                
                                    | Conjugation : | HIS | 
                                
                                    | Tissue specificity : | Isoform 1 is ubiquitous. Isoform 2 is expressed only in lymphoid tissues such as tonsils, lymph nodes and spleen, as well as peripheral blood mononuclear cells. | 
                                
                                    | Form : | Lyophilised:Reconstitute with 125 μl aqua dest. | 
                                
                                    | Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
                                
                                    | Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
                                
                                    | Sequences of amino acids : | MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQE IAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKK YSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKA VSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVA DLLASFNDQ | 
                                
                                    | Sequence Similarities : | Belongs to the peptidase C65 family.Contains 1 OTU domain. |