"PPP4C" Related Products

Expand
Expand
Expand

Recombinant Human PPP4C

Cat.No.: PPP4C-29539TH
Product Overview: Recombinant fragment of Human PPP4C with N terminal proprietary tag, predicted mwt: 35.53 kDa.
Description: Serine/threonine-protein phosphatase 4 catalytic subunit is an enzyme that in humans is encoded by the PPP4C gene.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL
Sequence Similarities: Belongs to the PPP phosphatase family. PP-4 (PP-X) subfamily.
Gene Name: PPP4C protein phosphatase 4, catalytic subunit [ Homo sapiens ]
Official Symbol: PPP4C
Synonyms: PPP4C; protein phosphatase 4, catalytic subunit; protein phosphatase 4 (formerly X), catalytic subunit; serine/threonine-protein phosphatase 4 catalytic subunit; PP4; PPX; protein phosphatase X; catalytic subunit;
Gene ID: 5531
mRNA Refseq: NM_002720
Protein Refseq: NP_002711
MIM: 602035
Uniprot ID: P60510
Chromosome Location: 16p11.2
Function: NF-kappaB-inducing kinase activity; hydrolase activity; metal ion binding; protein binding; protein serine/threonine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.