Recombinant Human PPP4C

Cat.No. : PPP4C-29539TH
Product Overview : Recombinant fragment of Human PPP4C with N terminal proprietary tag, predicted mwt: 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : Serine/threonine-protein phosphatase 4 catalytic subunit is an enzyme that in humans is encoded by the PPP4C gene.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL
Sequence Similarities : Belongs to the PPP phosphatase family. PP-4 (PP-X) subfamily.
Gene Name PPP4C protein phosphatase 4, catalytic subunit [ Homo sapiens ]
Official Symbol PPP4C
Synonyms PPP4C; protein phosphatase 4, catalytic subunit; protein phosphatase 4 (formerly X), catalytic subunit; serine/threonine-protein phosphatase 4 catalytic subunit; PP4; PPX; protein phosphatase X; catalytic subunit;
Gene ID 5531
mRNA Refseq NM_002720
Protein Refseq NP_002711
MIM 602035
Uniprot ID P60510
Chromosome Location 16p11.2
Function NF-kappaB-inducing kinase activity; hydrolase activity; metal ion binding; protein binding; protein serine/threonine phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP4C Products

Required fields are marked with *

My Review for All PPP4C Products

Required fields are marked with *

0
cart-icon
0
compare icon