Recombinant Human PSMB4, His-tagged PSMB4-30367TH

Recombinant Human PSMB4, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human PSMB4, His-tagged

Recombinant Human PSMB4, His-tagged

PSMB4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PSMB4-30367TH
Product Overview : Recombinant full length Human Proteasome subunit beta type 4 (amino acids 46-264) with an N terminal His tag; 240aa, 26.6kDa.
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.
Protein length : 219 amino acids
Conjugation : HIS
Molecular Weight : 26.600kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.02% DTT, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMTQNPMVTGTSVLGVKFEGG VVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYAD FQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSR RSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLAT GYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYR DARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
Sequence Similarities : Belongs to the peptidase T1B family.
Gene Name : PSMB4 proteasome (prosome, macropain) subunit, beta type, 4 [ Homo sapiens ]
Official Symbol : PSMB4
Synonyms : PSMB4; proteasome (prosome, macropain) subunit, beta type, 4; proteasome subunit beta type-4; HN3; PROS26;
Gene ID : 5692
mRNA Refseq : NM_002796
Protein Refseq : NP_002787
MIM : 602177
Uniprot ID : P28070
Chromosome Location : 1q21
Pathway : APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function : lipopolysaccharide binding; peptidase activity; threonine-type endopeptidase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy