Recombinant Human PSMB4, His-tagged
Cat.No. : | PSMB4-30367TH |
Product Overview : | Recombinant full length Human Proteasome subunit beta type 4 (amino acids 46-264) with an N terminal His tag; 240aa, 26.6kDa. |
- Specification
- Gene Information
- Related Products
Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. |
Protein length : | 219 amino acids |
Conjugation : | HIS |
Molecular Weight : | 26.600kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.02% DTT, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMTQNPMVTGTSVLGVKFEGG VVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYAD FQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSR RSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLAT GYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYR DARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE |
Sequence Similarities : | Belongs to the peptidase T1B family. |
Gene Name : | PSMB4 proteasome (prosome, macropain) subunit, beta type, 4 [ Homo sapiens ] |
Official Symbol : | PSMB4 |
Synonyms : | PSMB4; proteasome (prosome, macropain) subunit, beta type, 4; proteasome subunit beta type-4; HN3; PROS26; |
Gene ID : | 5692 |
mRNA Refseq : | NM_002796 |
Protein Refseq : | NP_002787 |
MIM : | 602177 |
Uniprot ID : | P28070 |
Chromosome Location : | 1q21 |
Pathway : | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Function : | lipopolysaccharide binding; peptidase activity; threonine-type endopeptidase activity; |
Products Types
◆ Recombinant Protein | ||
Psmb4-5180M | Recombinant Mouse Psmb4 Protein, Myc/DDK-tagged | +Inquiry |
Psmb4-1995M | Recombinant Mouse Psmb4 Protein, His-tagged | +Inquiry |
PSMB4-4432R | Recombinant Rat PSMB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMB4-3476R | Recombinant Rhesus Macaque PSMB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMB4-7212M | Recombinant Mouse PSMB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
PSMB4-2772HCL | Recombinant Human PSMB4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket