Recombinant Human PUF60, His-tagged
Cat.No. : | PUF60-31262TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-183 of Human PUF60 with an N terminal His tag. Predictec MWt: 21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-183 a.a. |
Description : | The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 107 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTD SIKMENGQSTAAKLGLPPLTPEQQEALQKAKKYAMEQS IKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQS MAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGP IKSIDMSWDSVTMKHKGFAFVEYEVPEAA |
Gene Name | PUF60 poly-U binding splicing factor 60KDa [ Homo sapiens ] |
Official Symbol | PUF60 |
Synonyms | PUF60; poly-U binding splicing factor 60KDa; poly(U)-binding-splicing factor PUF60; FBP interacting repressor; FIR; pyrimidine tract binding splicing factor; Ro ribonucleoprotein binding protein 1; RoBPI; siah binding protein 1; SIAHBP1; |
Gene ID | 22827 |
mRNA Refseq | NM_014281 |
Protein Refseq | NP_055096 |
MIM | 604819 |
Uniprot ID | Q9UHX1 |
Chromosome Location | 8q24.3 |
Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; |
Function | DNA binding; RNA binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
PUF60-1808H | Recombinant Human PUF60 Protein, His (Fc)-Avi-tagged | +Inquiry |
PUF60-4007H | Recombinant Human PUF60 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PUF60-97HFL | Active Recombinant Full Length Human PUF60 Protein, C-Flag-tagged | +Inquiry |
PUF60-13719M | Recombinant Mouse PUF60 Protein | +Inquiry |
PUF60-7299M | Recombinant Mouse PUF60 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PUF60-2665HCL | Recombinant Human PUF60 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PUF60 Products
Required fields are marked with *
My Review for All PUF60 Products
Required fields are marked with *