"PUF60" Related Products

Recombinant Human PUF60, His-tagged

Cat.No.: PUF60-31262TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-183 of Human PUF60 with an N terminal His tag. Predictec MWt: 21 kDa.
Description: The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 107 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTD SIKMENGQSTAAKLGLPPLTPEQQEALQKAKKYAMEQS IKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQS MAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGP IKSIDMSWDSVTMKHKGFAFVEYEVPEAA
Gene Name: PUF60 poly-U binding splicing factor 60KDa [ Homo sapiens ]
Official Symbol: PUF60
Synonyms: PUF60; poly-U binding splicing factor 60KDa; poly(U)-binding-splicing factor PUF60; FBP interacting repressor; FIR; pyrimidine tract binding splicing factor; Ro ribonucleoprotein binding protein 1; RoBPI; siah binding protein 1; SIAHBP1;
Gene ID: 22827
mRNA Refseq: NM_014281
Protein Refseq: NP_055096
MIM: 604819
Uniprot ID: Q9UHX1
Chromosome Location: 8q24.3
Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem;
Function: DNA binding; RNA binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.