Recombinant Human RANBP1
Cat.No. : | RANBP1-30900TH |
Product Overview : | Recombinant full length Human RanBP1 protein with an N terminal proprietary tag; predicted mwt: 49.11 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Ran/TC4-binding protein, RanBP1, interacts specifically with GTP-charged RAN. RANBP1 encodes a 23-kD protein that binds to RAN complexed with GTP but not GDP. RANBP1 does not activate GTPase activity of RAN but does markedly increase GTP hydrolysis by the RanGTPase-activating protein (RanGAP1). The RANBP1 cDNA encodes a 201-amino acid protein that is 92% similar to its mouse homolog. In both mammalian cells and in yeast, RANBP1 acts as a negative regulator of RCC1 by inhibiting RCC1-stimulated guanine nucleotide release from RAN. |
Protein length : | 210 amino acids |
Molecular Weight : | 49.110kDa |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKT LEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKH KEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRK EIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEK Q |
Sequence Similarities : | Belongs to the RANBP1 family.Contains 1 RanBD1 domain. |
Gene Name : | RANBP1 RAN binding protein 1 [ Homo sapiens ] |
Official Symbol : | RANBP1 |
Synonyms : | RANBP1; RAN binding protein 1; ran-specific GTPase-activating protein; HTF9A; |
Gene ID : | 5902 |
mRNA Refseq : | NM_002882 |
Protein Refseq : | NP_002873 |
MIM : | 601180 |
Uniprot ID : | P43487 |
Chromosome Location : | 22q11.21 |
Pathway : | E2F transcription factor network, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function : | GDP-dissociation inhibitor activity; GTPase activator activity; Ran GTPase binding; |
Products Types
◆ Recombinant Protein | ||
RANBP1-443H | Recombinant Human RANBP1 Protein, His-tagged | +Inquiry |
Ranbp1-5365M | Recombinant Mouse Ranbp1 Protein, Myc/DDK-tagged | +Inquiry |
RANBP1-3598R | Recombinant Rhesus Macaque RANBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RANBP1-7412M | Recombinant Mouse RANBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ranbp1-321X | Active Recombinant Xenopus laevis ranbp1 protein, His-tagged | +Inquiry |
◆ Lysates | ||
RANBP1-2534HCL | Recombinant Human RANBP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RANBP1 Products
Required fields are marked with *
My Review for All RANBP1 Products
Required fields are marked with *
0
Inquiry Basket