Recombinant Human RANBP1

• Cat.No.: RANBP1-30900TH
• Product Overview: Recombinant full length Human RanBP1 protein with an N terminal proprietary tag; predicted mwt: 49.11 kDa.

Specification

• Description: Ran/TC4-binding protein, RanBP1, interacts specifically with GTP-charged RAN. RANBP1 encodes a 23-kD protein that binds to RAN complexed with GTP but not GDP. RANBP1 does not activate GTPase activity of RAN but does markedly increase GTP hydrolysis by the RanGTPase-activating protein (RanGAP1). The RANBP1 cDNA encodes a 201-amino acid protein that is 92% similar to its mouse homolog. In both mammalian cells and in yeast, RANBP1 acts as a negative regulator of RCC1 by inhibiting RCC1-stimulated guanine nucleotide release from RAN.
• Protein length: 210 amino acids
• Molecular Weight: 49.110kDa
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKT LEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKH KEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRK EIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEK Q
• Sequence Similarities: Belongs to the RANBP1 family.Contains 1 RanBD1 domain.

Gene Information

• Gene Name: RANBP1 RAN binding protein 1 [ Homo sapiens ]
• Official Symbol: RANBP1
• Synonyms: RANBP1; RAN binding protein 1; ran-specific GTPase-activating protein; HTF9A
• Gene ID: 5902
• mRNA Refseq: NM_002882
• Protein Refseq: NP_002873
• MIM: 601180
• Uniprot ID: P43487
• Chromosome Location: 22q11.21
• Pathway: E2F transcription factor network, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem
• Function: GDP-dissociation inhibitor activity; GTPase activator activity; Ran GTPase binding