Recombinant Human RANBP1

Cat.No. : RANBP1-30900TH
Product Overview : Recombinant full length Human RanBP1 protein with an N terminal proprietary tag; predicted mwt: 49.11 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 210 amino acids
Description : Ran/TC4-binding protein, RanBP1, interacts specifically with GTP-charged RAN. RANBP1 encodes a 23-kD protein that binds to RAN complexed with GTP but not GDP. RANBP1 does not activate GTPase activity of RAN but does markedly increase GTP hydrolysis by the RanGTPase-activating protein (RanGAP1). The RANBP1 cDNA encodes a 201-amino acid protein that is 92% similar to its mouse homolog. In both mammalian cells and in yeast, RANBP1 acts as a negative regulator of RCC1 by inhibiting RCC1-stimulated guanine nucleotide release from RAN.
Molecular Weight : 49.110kDa
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKT LEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKH KEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRK EIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEK Q
Sequence Similarities : Belongs to the RANBP1 family.Contains 1 RanBD1 domain.
Gene Name RANBP1 RAN binding protein 1 [ Homo sapiens ]
Official Symbol RANBP1
Synonyms RANBP1; RAN binding protein 1; ran-specific GTPase-activating protein; HTF9A;
Gene ID 5902
mRNA Refseq NM_002882
Protein Refseq NP_002873
MIM 601180
Uniprot ID P43487
Chromosome Location 22q11.21
Pathway E2F transcription factor network, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function GDP-dissociation inhibitor activity; GTPase activator activity; Ran GTPase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RANBP1 Products

Required fields are marked with *

My Review for All RANBP1 Products

Required fields are marked with *

0
cart-icon