"RANBP1" Related Products

Expand
Expand

Recombinant Human RANBP1

Cat.No.: RANBP1-30900TH
Product Overview: Recombinant full length Human RanBP1 protein with an N terminal proprietary tag; predicted mwt: 49.11 kDa.
Description: Ran/TC4-binding protein, RanBP1, interacts specifically with GTP-charged RAN. RANBP1 encodes a 23-kD protein that binds to RAN complexed with GTP but not GDP. RANBP1 does not activate GTPase activity of RAN but does markedly increase GTP hydrolysis by the RanGTPase-activating protein (RanGAP1). The RANBP1 cDNA encodes a 201-amino acid protein that is 92% similar to its mouse homolog. In both mammalian cells and in yeast, RANBP1 acts as a negative regulator of RCC1 by inhibiting RCC1-stimulated guanine nucleotide release from RAN.
Protein length: 210 amino acids
Molecular Weight: 49.110kDa
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKT LEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKH KEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRK EIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEK Q
Sequence Similarities: Belongs to the RANBP1 family.Contains 1 RanBD1 domain.
Gene Name: RANBP1 RAN binding protein 1 [ Homo sapiens ]
Official Symbol: RANBP1
Synonyms: RANBP1; RAN binding protein 1; ran-specific GTPase-activating protein; HTF9A;
Gene ID: 5902
mRNA Refseq: NM_002882
Protein Refseq: NP_002873
MIM: 601180
Uniprot ID: P43487
Chromosome Location: 22q11.21
Pathway: E2F transcription factor network, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function: GDP-dissociation inhibitor activity; GTPase activator activity; Ran GTPase binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.