"RBM5" Related Products

Expand

Recombinant Human RBM5, His-tagged

Cat.No.: RBM5-31232TH
Product Overview: Recombinant fragment, corresponding to amino acids 582-815 of Human RBM5 with an N terminal His tag. Observed mwt: 33 kDa.
Description: This gene is a candidate tumor suppressor gene which encodes a nuclear RNA binding protein that is a component of the spliceosome A complex. The encoded protein plays a role in the induction of cell cycle arrest and apoptosis through pre-mRNA splicing of multiple target genes including the tumor suppressor protein p53. This gene is located within the tumor suppressor region 3p21.3, and may play a role in the inhibition of tumor transformation and progression of several malignancies including lung cancer.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 70 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GFALFEKKGALAERQQLIPELVRNGDEENPLKRGLVAAYS GDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNK DALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPT KDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEA QVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME
Gene Name: RBM5 RNA binding motif protein 5 [ Homo sapiens ]
Official Symbol: RBM5
Synonyms: RBM5; RNA binding motif protein 5; RNA-binding protein 5; H37; LUCA15;
Gene ID: 10181
mRNA Refseq: NM_005778
Protein Refseq: NP_005769
MIM: 606884
Uniprot ID: P52756
Chromosome Location: 3p21.3
Pathway: Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Processing, organism-specific biosystem; mRNA Splicing, organism-specific biosystem;
Function: DNA binding; RNA binding; mRNA binding; metal ion binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.