Recombinant Human RBM5, His-tagged
Cat.No. : | RBM5-31232TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 582-815 of Human RBM5 with an N terminal His tag. Observed mwt: 33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 582-815 a.a. |
Description : | This gene is a candidate tumor suppressor gene which encodes a nuclear RNA binding protein that is a component of the spliceosome A complex. The encoded protein plays a role in the induction of cell cycle arrest and apoptosis through pre-mRNA splicing of multiple target genes including the tumor suppressor protein p53. This gene is located within the tumor suppressor region 3p21.3, and may play a role in the inhibition of tumor transformation and progression of several malignancies including lung cancer. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 70 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GFALFEKKGALAERQQLIPELVRNGDEENPLKRGLVAAYS GDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNK DALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPT KDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEA QVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME |
Gene Name | RBM5 RNA binding motif protein 5 [ Homo sapiens ] |
Official Symbol | RBM5 |
Synonyms | RBM5; RNA binding motif protein 5; RNA-binding protein 5; H37; LUCA15; |
Gene ID | 10181 |
mRNA Refseq | NM_005778 |
Protein Refseq | NP_005769 |
MIM | 606884 |
Uniprot ID | P52756 |
Chromosome Location | 3p21.3 |
Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Processing, organism-specific biosystem; mRNA Splicing, organism-specific biosystem; |
Function | DNA binding; RNA binding; mRNA binding; metal ion binding; nucleotide binding; |
◆ Recombinant Proteins | ||
RBM5-2217H | Recombinant Human RBM5, GST-tagged | +Inquiry |
RBM5-31232TH | Recombinant Human RBM5, His-tagged | +Inquiry |
RBM5-4623R | Recombinant Rat RBM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBM5-3639R | Recombinant Rhesus Macaque RBM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBM5-5879Z | Recombinant Zebrafish RBM5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM5-2466HCL | Recombinant Human RBM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM5 Products
Required fields are marked with *
My Review for All RBM5 Products
Required fields are marked with *