Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human ROM1

Cat.No. : ROM1-30954TH
Product Overview : Recombinant fragment of Human ROM1 with an N terminal proprietary tag; Predicted MWt 36.85 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is a member of a photoreceptor-specific gene family and encodes an integral membrane protein found in the photoreceptor disk rim of the eye. This protein can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.
Protein length : 102 amino acids
Molecular Weight : 36.850kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Retina (photoreceptor). In rim region of ROS (rod outer segment) disks.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSN VEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPR QPNQNLWAQGCHEVLLEHLQDL
Sequence Similarities : Belongs to the PRPH2/ROM1 family.
Gene Name : ROM1 retinal outer segment membrane protein 1 [ Homo sapiens ]
Official Symbol : ROM1
Synonyms : ROM1; retinal outer segment membrane protein 1; rod outer segment membrane protein 1; ROM; TSPAN23;
Gene ID : 6094
mRNA Refseq : NM_000327
Protein Refseq : NP_000318
MIM : 180721
Uniprot ID : Q03395
Chromosome Location : 11q13

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends