Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human RRM1

Cat.No. : RRM1-29473TH
Product Overview : Recombinant fragment of Human RRM1 (amino acids 644-753) with N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTV WEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSM HFYGWKQGLKTGMYYLRTRPAANPIQFTLN
Sequence Similarities : Belongs to the ribonucleoside diphosphate reductase large chain family.Contains 1 ATP-cone domain.
Gene Name : RRM1 ribonucleotide reductase M1 [ Homo sapiens ]
Official Symbol : RRM1
Synonyms : RRM1; ribonucleotide reductase M1; ribonucleotide reductase M1 polypeptide; ribonucleoside-diphosphate reductase large subunit;
Gene ID : 6240
mRNA Refseq : NM_001033
Protein Refseq : NP_001024
MIM : 180410
Uniprot ID : P23921
Chromosome Location : 11p15.5
Pathway : E2F transcription factor network, organism-specific biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function : ATP binding; oxidoreductase activity; purine nucleotide binding; ribonucleoside-diphosphate reductase activity; ribonucleoside-diphosphate reductase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends