Recombinant Human RUNX1

Cat.No. : RUNX1-27497TH
Product Overview : Recombinant fragment corresponding to amino acids 210-311 of Human RUNX1 / AML1 with a proprietary tag at N-terminal; predicted MWt 37.22 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 102 amino acids
Description : Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 37.220kDa inclusive of tags
Tissue specificity : Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
Sequence Similarities : Contains 1 Runt domain.
Gene Name RUNX1 runt-related transcription factor 1 [ Homo sapiens ]
Official Symbol RUNX1
Synonyms RUNX1; runt-related transcription factor 1; acute myeloid leukemia 1 , AML1, CBFA2; aml1 oncogene; AMLCR1; PEBP2A2;
Gene ID 861
mRNA Refseq NM_001001890
Protein Refseq NP_001001890
MIM 151385
Uniprot ID Q01196
Chromosome Location 21q22.3
Pathway Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem;
Function ATP binding; DNA binding; DNA binding; calcium ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RUNX1 Products

Required fields are marked with *

My Review for All RUNX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon