"RUNX1" Related Products

Expand
Expand
Expand

Recombinant Human RUNX1

Cat.No.: RUNX1-27497TH
Product Overview: Recombinant fragment corresponding to amino acids 210-311 of Human RUNX1 / AML1 with a proprietary tag at N-terminal; predicted MWt 37.22 kDa inclusive of tag.
Description: Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.
Protein length: 102 amino acids
Molecular Weight: 37.220kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
Sequence Similarities: Contains 1 Runt domain.
Gene Name: RUNX1 runt-related transcription factor 1 [ Homo sapiens ]
Official Symbol: RUNX1
Synonyms: RUNX1; runt-related transcription factor 1; acute myeloid leukemia 1 , AML1, CBFA2; aml1 oncogene; AMLCR1; PEBP2A2;
Gene ID: 861
mRNA Refseq: NM_001001890
Protein Refseq: NP_001001890
MIM: 151385
Uniprot ID: Q01196
Chromosome Location: 21q22.3
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem;
Function: ATP binding; DNA binding; DNA binding; calcium ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.