"SGCG" Related Products

Expand

Recombinant Human SGCG

Cat.No.: SGCG-26403TH
Product Overview: Recombinant fragment corresponding to amino acids 191-290 of Human gamma Sarcoglycan with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in skeletal and heart muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHIC
Sequence Similarities: Belongs to the sarcoglycan beta/delta/gamma/zeta family.
Gene Name: SGCG sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) [ Homo sapiens ]
Official Symbol: SGCG
Synonyms: SGCG; sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein); DMDA1, LGMD2C, MAM, sarcoglycan, gamma (35kD dystrophin associated glycoprotein); gamma-sarcoglycan; 35kD dystrophin associated glycoprotein; A4; DAGA4; DMDA; gamma sarcoglycan; limb gi
Gene ID: 6445
mRNA Refseq: NM_000231
Protein Refseq: NP_000222
MIM: 608896
Uniprot ID: Q13326
Chromosome Location: 13q12-q13
Pathway: Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.