Recombinant Human SH3GL1, His-tagged
Cat.No. : | SH3GL1-30812TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 6-368 of Human SH3 containing Grb 2 like 1 protein with a N terminal His tag; Predicted MWt 43 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the endophilin family of Src homology 3 domain-containing proteins. The encoded protein is involved in endocytosis and may also play a role in the cell cycle. Overexpression of this gene may play a role in leukemogenesis, and the encoded protein has been implicated in acute myeloid leukemia as a fusion partner of the myeloid-lymphoid leukemia protein. Pseudogenes of this gene are located on the long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitous. Higher expression in pancreas, placenta, prostate, testis and uterus. |
Form : | Lyophilised:Reconstitute with 99 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSK AVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKN PGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESM KRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKL EGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAET SMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELA EKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGF PCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALY DFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSG FFPLSYVEVLVPLPQ |
Sequence Similarities : | Belongs to the endophilin family.Contains 1 BAR domain.Contains 1 SH3 domain. |
Gene Name : | SH3GL1 SH3-domain GRB2-like 1 [ Homo sapiens ] |
Official Symbol : | SH3GL1 |
Synonyms : | SH3GL1; SH3-domain GRB2-like 1; endophilin-A2; CNSA1; EEN; extra 11 19 leukemia fusion; fusion partner of MLL; MGC111371; SH3 domain GRB2 like 1; SH3 containing Grb 2 like 1 protein; SH3 containing protein EEN; SH3D2B; SH3P8; |
Gene ID : | 6455 |
mRNA Refseq : | NM_001199944 |
Protein Refseq : | NP_001186873 |
MIM : | 601768 |
Uniprot ID : | Q99961 |
Chromosome Location : | 19p13.3 |
Pathway : | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Signaling events mediated by focal adhesion kinase, organism-specific biosystem; |
Function : | lipid binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
SH3GL1-5037R | Recombinant Rat SH3GL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SH3GL1-2003H | Recombinant Human SH3GL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sh3gl1-5844M | Recombinant Mouse Sh3gl1 Protein, Myc/DDK-tagged | +Inquiry |
SH3GL1-6098C | Recombinant Chicken SH3GL1 | +Inquiry |
SH3GL1-301164H | Recombinant Human SH3GL1 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
SH3GL1-1868HCL | Recombinant Human SH3GL1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket