Recombinant Human SH3GL2
Cat.No. : | SH3GL2-30063TH |
Product Overview : | Recombinant fragment of Human SH3GL2 with proprietary tag at N-terminal; Predicted MW 56.8kDa. |
- Specification
- Gene Information
- Related Products
Description : | Endophilin-A1 is a protein that in humans is encoded by the SH3GL2 gene. |
Protein length : | 279 amino acids |
Molecular Weight : | 56.800kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Brain, mostly in frontal cortex. Expressed at high level in fetal cerebellum. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKV DVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQ GKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA MRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKK LEGRRLDFDYKKERQGKIPDEELHQALEKFDESKEIAESS MFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSH |
Sequence Similarities : | Belongs to the endophilin family.Contains 1 BAR domain.Contains 1 SH3 domain. |
Gene Name : | SH3GL2 SH3-domain GRB2-like 2 [ Homo sapiens ] |
Official Symbol : | SH3GL2 |
Synonyms : | SH3GL2; SH3-domain GRB2-like 2; endophilin-A1; CNSA2; EEN B1; SH3D2A; SH3P4; |
Gene ID : | 6456 |
mRNA Refseq : | NM_003026 |
Protein Refseq : | NP_003017 |
MIM : | 604465 |
Uniprot ID : | Q99962 |
Chromosome Location : | 9p22 |
Pathway : | Axon guidance, organism-specific biosystem; Clathrin derived vesicle budding, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EGFR downregulation, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; |
Function : | identical protein binding; lipid binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
Sh3gl2-5845M | Recombinant Mouse Sh3gl2 Protein, Myc/DDK-tagged | +Inquiry |
SH3GL2-386H | Recombinant Human SH3GL2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
SH3GL2-8128M | Recombinant Mouse SH3GL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SH3GL2-5038R | Recombinant Rat SH3GL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SH3GL2-15846H | Recombinant Human SH3GL2, His-tagged | +Inquiry |
◆ Lysates | ||
SH3GL2-1867HCL | Recombinant Human SH3GL2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket