Recombinant Human SLC1A3
| Cat.No. : | SLC1A3-26509TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 162-237 of Human EAAT1 with an N terminal proprietary tag; Predicted MWt 33.99. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 76 amino acids |
| Description : | This gene encodes a member of a member of a high affinity glutamate transporter family. Mutations in this gene are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants. |
| Molecular Weight : | 33.990kDa inclusive of tags |
| Tissue specificity : | Highly expressed in cerebellum, but also found in frontal cortex, hippocampus and basal ganglia. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS |
| Sequence Similarities : | Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A3 subfamily. |
| Gene Name | SLC1A3 solute carrier family 1 (glial high affinity glutamate transporter), member 3 [ Homo sapiens ] |
| Official Symbol | SLC1A3 |
| Synonyms | SLC1A3; solute carrier family 1 (glial high affinity glutamate transporter), member 3; excitatory amino acid transporter 1; EA6; EAAT1; GLAST; glutamate transporter variant EAAT1ex9skip; |
| Gene ID | 6507 |
| mRNA Refseq | NM_001166695 |
| Protein Refseq | NP_001160167 |
| MIM | 600111 |
| Uniprot ID | P43003 |
| Chromosome Location | 5p13 |
| Pathway | Astrocytic Glutamate-Glutamine Uptake And Metabolism, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter uptake and Metabolism In Glial Cells, organism-specific biosystem; |
| Function | L-glutamate transmembrane transporter activity; glutamate binding; high-affinity glutamate transmembrane transporter activity; sodium:dicarboxylate symporter activity; symporter activity; |
| ◆ Recombinant Proteins | ||
| SLC1A3-4231R | Recombinant Rhesus monkey SLC1A3 Protein, His-tagged | +Inquiry |
| SLC1A3-2704H | Recombinant Human SLC1A3, GST-tagged | +Inquiry |
| SLC1A3-1376H | Recombinant Human SLC1A3 protein, His-KSI-tagged | +Inquiry |
| SLC1A3-745H | Recombinant Human SLC1A3 protein, His-KSI-tagged | +Inquiry |
| SLC1A3-4047R | Recombinant Rhesus Macaque SLC1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC1A3-1619HCL | Recombinant Human SLC1A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC1A3 Products
Required fields are marked with *
My Review for All SLC1A3 Products
Required fields are marked with *




