Recombinant Human SLC1A3

Cat.No. : SLC1A3-26509TH
Product Overview : Recombinant fragment corresponding to amino acids 162-237 of Human EAAT1 with an N terminal proprietary tag; Predicted MWt 33.99.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 76 amino acids
Description : This gene encodes a member of a member of a high affinity glutamate transporter family. Mutations in this gene are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants.
Molecular Weight : 33.990kDa inclusive of tags
Tissue specificity : Highly expressed in cerebellum, but also found in frontal cortex, hippocampus and basal ganglia.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS
Sequence Similarities : Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A3 subfamily.
Gene Name SLC1A3 solute carrier family 1 (glial high affinity glutamate transporter), member 3 [ Homo sapiens ]
Official Symbol SLC1A3
Synonyms SLC1A3; solute carrier family 1 (glial high affinity glutamate transporter), member 3; excitatory amino acid transporter 1; EA6; EAAT1; GLAST; glutamate transporter variant EAAT1ex9skip;
Gene ID 6507
mRNA Refseq NM_001166695
Protein Refseq NP_001160167
MIM 600111
Uniprot ID P43003
Chromosome Location 5p13
Pathway Astrocytic Glutamate-Glutamine Uptake And Metabolism, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter uptake and Metabolism In Glial Cells, organism-specific biosystem;
Function L-glutamate transmembrane transporter activity; glutamate binding; high-affinity glutamate transmembrane transporter activity; sodium:dicarboxylate symporter activity; symporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC1A3 Products

Required fields are marked with *

My Review for All SLC1A3 Products

Required fields are marked with *

0
cart-icon