"SLC1A3" Related Products

Expand

Recombinant Human SLC1A3

Cat.No.: SLC1A3-26509TH
Product Overview: Recombinant fragment corresponding to amino acids 162-237 of Human EAAT1 with an N terminal proprietary tag; Predicted MWt 33.99.
Description: This gene encodes a member of a member of a high affinity glutamate transporter family. Mutations in this gene are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants.
Protein length: 76 amino acids
Molecular Weight: 33.990kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in cerebellum, but also found in frontal cortex, hippocampus and basal ganglia.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS
Sequence Similarities: Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A3 subfamily.
Gene Name: SLC1A3 solute carrier family 1 (glial high affinity glutamate transporter), member 3 [ Homo sapiens ]
Official Symbol: SLC1A3
Synonyms: SLC1A3; solute carrier family 1 (glial high affinity glutamate transporter), member 3; excitatory amino acid transporter 1; EA6; EAAT1; GLAST; glutamate transporter variant EAAT1ex9skip;
Gene ID: 6507
mRNA Refseq: NM_001166695
Protein Refseq: NP_001160167
MIM: 600111
Uniprot ID: P43003
Chromosome Location: 5p13
Pathway: Astrocytic Glutamate-Glutamine Uptake And Metabolism, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter uptake and Metabolism In Glial Cells, organism-specific biosystem;
Function: L-glutamate transmembrane transporter activity; glutamate binding; high-affinity glutamate transmembrane transporter activity; sodium:dicarboxylate symporter activity; symporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.