"SLC37A4" Related Products

Expand

Recombinant Human SLC37A4

Cat.No.: SLC37A4-31417TH
Product Overview: Recombinant fragment of Human SLC37A4 with an N terminal proprietary tag; Predicted MWt 31.02 kDa.
Description: This gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, in order to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of the endoplasmic reticulum. Mutations in this gene have been associated with various forms of glycogen storage disease. Alternative splicing in this gene results in multiple transcript variants.
Protein length: 49 amino acids
Molecular Weight: 31.020kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Mostly expressed in liver and kidney.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA
Sequence Similarities: Belongs to the major facilitator superfamily. Organophosphate:Pi antiporter (OPA) (TC 2.A.1.4) family.
Gene Name: SLC37A4 solute carrier family 37 (glucose-6-phosphate transporter), member 4 [ Homo sapiens ]
Official Symbol: SLC37A4
Synonyms: SLC37A4; solute carrier family 37 (glucose-6-phosphate transporter), member 4; G6PT1, G6PT2, G6PT3, glucose 6 phosphatase, transport (glucose 6 phosphate) protein 1; glucose-6-phosphate translocase; GSD1b; GSD1c; GSD1d;
Gene ID: 2542
mRNA Refseq: NM_001164277
Protein Refseq: NP_001157749
MIM: 602671
Uniprot ID: O43826
Chromosome Location: 11q23.3
Pathway: Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; Glucose transport, organism-specific biosystem; Hexose transport, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem;
Function: glucose-6-phosphate transmembrane transporter activity; glucose-6-phosphate transmembrane transporter activity; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.