Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human SLC37A4

Cat.No. : SLC37A4-31417TH
Product Overview : Recombinant fragment of Human SLC37A4 with an N terminal proprietary tag; Predicted MWt 31.02 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, in order to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of the endoplasmic reticulum. Mutations in this gene have been associated with various forms of glycogen storage disease. Alternative splicing in this gene results in multiple transcript variants.
Protein length : 49 amino acids
Molecular Weight : 31.020kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Mostly expressed in liver and kidney.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA
Sequence Similarities : Belongs to the major facilitator superfamily. Organophosphate:Pi antiporter (OPA) (TC 2.A.1.4) family.
Gene Name : SLC37A4 solute carrier family 37 (glucose-6-phosphate transporter), member 4 [ Homo sapiens ]
Official Symbol : SLC37A4
Synonyms : SLC37A4; solute carrier family 37 (glucose-6-phosphate transporter), member 4; G6PT1, G6PT2, G6PT3, glucose 6 phosphatase, transport (glucose 6 phosphate) protein 1; glucose-6-phosphate translocase; GSD1b; GSD1c; GSD1d;
Gene ID : 2542
mRNA Refseq : NM_001164277
Protein Refseq : NP_001157749
MIM : 602671
Uniprot ID : O43826
Chromosome Location : 11q23.3
Pathway : Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; Glucose transport, organism-specific biosystem; Hexose transport, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem;
Function : glucose-6-phosphate transmembrane transporter activity; glucose-6-phosphate transmembrane transporter activity; transporter activity;

Products Types

◆ Recombinant Protein
SLC37A4-0569H Recombinant Human SLC37A4 Protein (A2-E429), 8×His-MBP, Flag tagged +Inquiry
SLC37A4-4098R Recombinant Rhesus Macaque SLC37A4 Protein, His (Fc)-Avi-tagged +Inquiry
SLC37A4-5789H Recombinant Human SLC37A4 Protein (Met1-Cys176), C-His tagged +Inquiry
SLC37A4-0416H Recombinant Human SLC37A4 Protein (Met1-Cys176), C-His-tagged +Inquiry
SLC37A4-2758H Recombinant Human SLC37A4, GST-tagged +Inquiry

See All SLC37A4 Recombinant Protein

◆ Lysates
SLC37A4-1726HCL Recombinant Human SLC37A4 293 Cell Lysate +Inquiry

See All SLC37A4 Lysates

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends