Recombinant Human SLC37A4
Cat.No. : | SLC37A4-31417TH |
Product Overview : | Recombinant fragment of Human SLC37A4 with an N terminal proprietary tag; Predicted MWt 31.02 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, in order to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of the endoplasmic reticulum. Mutations in this gene have been associated with various forms of glycogen storage disease. Alternative splicing in this gene results in multiple transcript variants. |
Protein length : | 49 amino acids |
Molecular Weight : | 31.020kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Mostly expressed in liver and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA |
Sequence Similarities : | Belongs to the major facilitator superfamily. Organophosphate:Pi antiporter (OPA) (TC 2.A.1.4) family. |
Gene Name : | SLC37A4 solute carrier family 37 (glucose-6-phosphate transporter), member 4 [ Homo sapiens ] |
Official Symbol : | SLC37A4 |
Synonyms : | SLC37A4; solute carrier family 37 (glucose-6-phosphate transporter), member 4; G6PT1, G6PT2, G6PT3, glucose 6 phosphatase, transport (glucose 6 phosphate) protein 1; glucose-6-phosphate translocase; GSD1b; GSD1c; GSD1d; |
Gene ID : | 2542 |
mRNA Refseq : | NM_001164277 |
Protein Refseq : | NP_001157749 |
MIM : | 602671 |
Uniprot ID : | O43826 |
Chromosome Location : | 11q23.3 |
Pathway : | Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; Glucose transport, organism-specific biosystem; Hexose transport, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; |
Function : | glucose-6-phosphate transmembrane transporter activity; glucose-6-phosphate transmembrane transporter activity; transporter activity; |
Products Types
◆ Recombinant Protein | ||
SLC37A4-0569H | Recombinant Human SLC37A4 Protein (A2-E429), 8×His-MBP, Flag tagged | +Inquiry |
SLC37A4-4098R | Recombinant Rhesus Macaque SLC37A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC37A4-5789H | Recombinant Human SLC37A4 Protein (Met1-Cys176), C-His tagged | +Inquiry |
SLC37A4-0416H | Recombinant Human SLC37A4 Protein (Met1-Cys176), C-His-tagged | +Inquiry |
SLC37A4-2758H | Recombinant Human SLC37A4, GST-tagged | +Inquiry |
◆ Lysates | ||
SLC37A4-1726HCL | Recombinant Human SLC37A4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket