"SMTN" Related Products

Expand

Recombinant Human SMTN, His-tagged

Cat.No.: SMTN-31420TH
Product Overview: Recombinant fragment, corresponding to amino acids 707-915 of Human Smoothelin with N terminal His tag; 209 amino acids, 26kDa.
Description: This gene encodes a structural protein that is found exclusively in contractile smooth muscle cells. It associates with stress fibers and constitutes part of the cytoskeleton. This gene is localized to chromosome 22q12.3, distal to the TUPLE1 locus and outside the DiGeorge syndrome deletion. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 126 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: KTFSSSSSSKKMGSIFDREDQASPRAGSLAALEKRQAEKK KELMKAQSLPKTSASQARKAMIEKLEKEGAAGSPGGPR AAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNF SSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEV AFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEF YRCLVQKGLVKTKKS
Gene Name: SMTN smoothelin [ Homo sapiens ]
Official Symbol: SMTN
Synonyms: SMTN; smoothelin;
Gene ID: 6525
mRNA Refseq: NM_001207017
Protein Refseq: NP_001193946
MIM: 602127
Uniprot ID: P53814
Chromosome Location: 22q12
Function: actin binding; structural constituent of muscle;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.