Recombinant Human SMTN, His-tagged
Cat.No. : | SMTN-31420TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 707-915 of Human Smoothelin with N terminal His tag; 209 amino acids, 26kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a structural protein that is found exclusively in contractile smooth muscle cells. It associates with stress fibers and constitutes part of the cytoskeleton. This gene is localized to chromosome 22q12.3, distal to the TUPLE1 locus and outside the DiGeorge syndrome deletion. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 126 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | KTFSSSSSSKKMGSIFDREDQASPRAGSLAALEKRQAEKK KELMKAQSLPKTSASQARKAMIEKLEKEGAAGSPGGPR AAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNF SSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEV AFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEF YRCLVQKGLVKTKKS |
Gene Name : | SMTN smoothelin [ Homo sapiens ] |
Official Symbol : | SMTN |
Synonyms : | SMTN; smoothelin; |
Gene ID : | 6525 |
mRNA Refseq : | NM_001207017 |
Protein Refseq : | NP_001193946 |
MIM : | 602127 |
Uniprot ID : | P53814 |
Chromosome Location : | 22q12 |
Function : | actin binding; structural constituent of muscle; |
Products Types
◆ Recombinant Protein | ||
Smtn-5980M | Recombinant Mouse Smtn Protein, Myc/DDK-tagged | +Inquiry |
SMTN-8502M | Recombinant Mouse SMTN Protein, His (Fc)-Avi-tagged | +Inquiry |
SMTN-2049H | Recombinant Human SMTN Protein, His (Fc)-Avi-tagged | +Inquiry |
SMTN-8113H | Recombinant Human SMTN protein, His & GST-tagged | +Inquiry |
SMTN-15649M | Recombinant Mouse SMTN Protein | +Inquiry |
◆ Lysates | ||
SMTN-1650HCL | Recombinant Human SMTN 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All SMTN Products
Required fields are marked with *
My Review for All SMTN Products
Required fields are marked with *
0
Inquiry Basket