"SPTBN1" Related Products

Recombinant Human SPTBN1, His-tagged

Cat.No.: SPTBN1-30885TH
Product Overview: Recombinant fragment, corresponding to amino acids 280-692 of Human SPTBN1 with an N terminal His tag; Predicted MWt 49 kDa.
Description: Spectrin is an actin crosslinking and molecular scaffold protein that links the plasma membrane to the actin cytoskeleton, and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. It is composed of two antiparallel dimers of alpha- and beta- subunits. This gene is one member of a family of beta-spectrin genes. The encoded protein contains an N-terminal actin-binding domain, and 17 spectrin repeats which are involved in dimer formation. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 24 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIE QTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFT EKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKA WERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAM RETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAA YEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWE YLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKV LVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGV NASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQ LAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDD YGKDLTSVMRLLSKHRAFEDEMSGRSG
Gene Name: SPTBN1 spectrin, beta, non-erythrocytic 1 [ Homo sapiens ]
Official Symbol: SPTBN1
Synonyms: SPTBN1; spectrin, beta, non-erythrocytic 1; spectrin beta chain, brain 1;
Gene ID: 6711
mRNA Refseq: NM_178313
Protein Refseq: NP_842565
MIM: 182790
Uniprot ID: Q01082
Chromosome Location: 2p21
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function: actin binding; calmodulin binding; protein binding; structural constituent of cytoskeleton;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.