Recombinant Human SPTBN1, His-tagged
Cat.No. : | SPTBN1-30885TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 280-692 of Human SPTBN1 with an N terminal His tag; Predicted MWt 49 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 280-692 a.a. |
Description : | Spectrin is an actin crosslinking and molecular scaffold protein that links the plasma membrane to the actin cytoskeleton, and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. It is composed of two antiparallel dimers of alpha- and beta- subunits. This gene is one member of a family of beta-spectrin genes. The encoded protein contains an N-terminal actin-binding domain, and 17 spectrin repeats which are involved in dimer formation. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 24 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIE QTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFT EKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKA WERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAM RETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAA YEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWE YLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKV LVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGV NASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQ LAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDD YGKDLTSVMRLLSKHRAFEDEMSGRSG |
Gene Name | SPTBN1 spectrin, beta, non-erythrocytic 1 [ Homo sapiens ] |
Official Symbol | SPTBN1 |
Synonyms | SPTBN1; spectrin, beta, non-erythrocytic 1; spectrin beta chain, brain 1; |
Gene ID | 6711 |
mRNA Refseq | NM_178313 |
Protein Refseq | NP_842565 |
MIM | 182790 |
Uniprot ID | Q01082 |
Chromosome Location | 2p21 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function | actin binding; calmodulin binding; protein binding; structural constituent of cytoskeleton; |
◆ Recombinant Proteins | ||
SPTBN1-200HCL | Recombinant Human SPTBN1 cell lysate, Myc/DDK-tagged | +Inquiry |
SPTBN1-30885TH | Recombinant Human SPTBN1, His-tagged | +Inquiry |
SPTBN1-1639C | Recombinant Cynomolgus SPTBN1 protein, His-tagged | +Inquiry |
SPTBN1-4456R | Recombinant Rhesus monkey SPTBN1 Protein, His-tagged | +Inquiry |
SPTBN1-4272R | Recombinant Rhesus Macaque SPTBN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPTBN1 Products
Required fields are marked with *
My Review for All SPTBN1 Products
Required fields are marked with *