Recombinant Human TAZ

Cat.No. : TAZ-30938TH
Product Overview : Recombinant full length Human Tafazzin/TAZ protein with an N terminal proprietary tag; predicted mwt: 54.56 kDa with the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 262 amino acids
Description : This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
Molecular Weight : 54.560kDa inclusive of tags
Tissue specificity : High levels in cardiac and skeletal muscle. Up to 10 isoforms can be present in different amounts in different tissues. Most isoforms are ubiquitous. Isoforms that lack the N-terminus are found in leukocytes and fibroblasts, but not in heart and skeletal
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWA QAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFT KELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWV HIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGV GGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPR FGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFI QEEFQHLKTQAEQLHNHLQPGR
Sequence Similarities : Belongs to the taffazin family.
Gene Name TAZ tafazzin [ Homo sapiens ]
Official Symbol TAZ
Synonyms TAZ; tafazzin; cardiomyopathy, dilated 3A (X linked) , CMD3A, EFE, EFE2, endocardial fibroelastosis 2; Barth syndrome; BTHS; G4.5; XAP 2;
Gene ID 6901
mRNA Refseq NM_000116
Protein Refseq NP_000107
MIM 300394
Uniprot ID Q16635
Chromosome Location Xq28
Pathway Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem;
Function 1-acylglycerophosphocholine O-acyltransferase activity; transferase activity, transferring acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAZ Products

Required fields are marked with *

My Review for All TAZ Products

Required fields are marked with *

0
cart-icon
0
compare icon