| Cat.No.: | TCEAL1-30813TH |
| Product Overview: | Recombinant full length Human TCEAL1 Isoform 2 with C terminal His tag; 167 amino acids with tag; Predicted MWt 19.7 kDa. |
| Description: | This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. |
| Protein length: | 159 amino acids |
| Conjugation: | HIS |
| Molecular Weight: | 19.700kDa inclusive of tags |
| Source: | E. coli |
| Tissue specificity: | Expressed in all tissues examined. Highly expressed in heart, ovary, prostate and skeletal muscle. Moderately expressed in brain, placenta, testis and small intestine. Weakly expressed in lung, liver and spleen. Expressed in several cancer cell lines. |
| Form: | Liquid |
| Purity: | >90% by SDS-PAGE |
| Storage buffer: | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
| Storage: | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids: | MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPILEHHHHHH |
| Sequence Similarities: | Belongs to the TFS-II family. TFA subfamily. |
| Gene Name: | TCEAL1 transcription elongation factor A (SII)-like 1 [ Homo sapiens ] |
| Official Symbol: | TCEAL1 |
| Synonyms: | TCEAL1; transcription elongation factor A (SII)-like 1; transcription elongation factor A protein-like 1; P21; p21; pp21; SIIR; |
| Gene ID: | 9338 |
| mRNA Refseq: | NM_001006639 |
| Protein Refseq: | NP_001006640 |
| MIM: | 300237 |
| Uniprot ID: | Q15170 |
| Chromosome Location: | Xq22.1 |
| Function: | sequence-specific DNA binding transcription factor activity; |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All TCEAL1 Products
Download Datasheet