Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human UCP3, His-tagged

Cat.No. : UCP3-30102TH
Product Overview : Recombinant fragment: GTLPNIMRNA IVNCAEVVTY DILKEKLLDY HLLT, corresponding to amino acids 181-214 of Human UCP3 fused to His tag, 10kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. The different UCPs have tissue-specific expression; this gene is primarily expressed in skeletal muscle. This genes protein product is postulated to protect mitochondria against lipid-induced oxidative stress. Expression levels of this gene increase when fatty acid supplies to mitochondria exceed their oxidation capacity and the protein enables the export of fatty acids from mitochondria. UCPs contain the three solcar protein domains typically found in MACPs. Two splice variants have been found for this gene.
Conjugation : HIS
Source : E. coli
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 1X PBS
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLT
Gene Name : UCP3 uncoupling protein 3 (mitochondrial, proton carrier) [ Homo sapiens ]
Official Symbol : UCP3
Synonyms : UCP3; uncoupling protein 3 (mitochondrial, proton carrier); mitochondrial uncoupling protein 3; SLC25A9;
Gene ID : 7352
mRNA Refseq : NM_003356
Protein Refseq : NP_003347
MIM : 602044
Uniprot ID : P55916
Chromosome Location : 11q13.4
Pathway : Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Electron Transport Chain, organism-specific biosystem; Energy Metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Mitochondrial Uncoupling Proteins, organism-specific biosystem;
Function : binding; oxidative phosphorylation uncoupler activity; transporter activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends