"YEATS4" Related Products

Expand
Expand

Recombinant Human YEATS4, His-tagged

Cat.No.: YEATS4-28475TH
Product Overview: Recombinant full length Human GAS41 with N terminal His tag; 250 amino acids with tag, Predicted MWt 28.9 kDa.
Description: The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
Protein length: 227 amino acids
Conjugation: HIS
Molecular Weight: 28.900kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.03% DTT, 1.17% Sodium chloride, 0.002% PMSF
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMFKRMAEFGPDSGGRVK GVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNE DMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFE IIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSE FYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEV KTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRK LEEDDQAKDI
Sequence Similarities: Contains 1 YEATS domain.
Gene Name: YEATS4 YEATS domain containing 4 [ Homo sapiens ]
Official Symbol: YEATS4
Synonyms: YEATS4; YEATS domain containing 4; YEATS domain-containing protein 4; GAS41; NuBI 1; YAF9;
Gene ID: 8089
mRNA Refseq: NM_006530
Protein Refseq: NP_006521
MIM: 602116
Uniprot ID: O95619
Chromosome Location: 12q13-q15
Pathway: C-MYB transcription factor network, organism-specific biosystem;
Function: DNA binding; protein C-terminus binding; protein binding; sequence-specific DNA binding transcription factor activity; structural constituent of cytoskeleton;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.