Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human YEATS4, His-tagged

Cat.No. : YEATS4-28475TH
Product Overview : Recombinant full length Human GAS41 with N terminal His tag; 250 amino acids with tag, Predicted MWt 28.9 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
Protein length : 227 amino acids
Conjugation : HIS
Molecular Weight : 28.900kDa inclusive of tags
Source : E. coli
Tissue specificity : Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.03% DTT, 1.17% Sodium chloride, 0.002% PMSF
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMFKRMAEFGPDSGGRVK GVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNE DMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFE IIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSE FYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEV KTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRK LEEDDQAKDI
Sequence Similarities : Contains 1 YEATS domain.
Gene Name : YEATS4 YEATS domain containing 4 [ Homo sapiens ]
Official Symbol : YEATS4
Synonyms : YEATS4; YEATS domain containing 4; YEATS domain-containing protein 4; GAS41; NuBI 1; YAF9;
Gene ID : 8089
mRNA Refseq : NM_006530
Protein Refseq : NP_006521
MIM : 602116
Uniprot ID : O95619
Chromosome Location : 12q13-q15
Pathway : C-MYB transcription factor network, organism-specific biosystem;
Function : DNA binding; protein C-terminus binding; protein binding; sequence-specific DNA binding transcription factor activity; structural constituent of cytoskeleton;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All YEATS4 Products

Required fields are marked with *

My Review for All YEATS4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends