"SERPINF1" Related Products

Expand
Expand
Expand

Recombinant Human SERPINF1, FLAG-tagged

Cat. No.: SERPINF1-25H
Product Overview: Recombinant Human SERPINF1produced inHEK293 cellsis a single, glycosylated, polypeptide chain containing 410 amino acids and having a molecular mass of 45.6 kDa. The Human Sentrin-F1 is fused to FLAG tag at N-Terminus. The Human PEDF is purified by proprietary chromatographic techniques.
Description: PEDF is a neurotrophic protein that induces extensive neuronal differentiation in retinoblastoma cells. SerpinF1 is a potent inhibitor of angiogenesis. EPC1 doesn"t undergo the stressed to relaxed conformation transition characteristic as of the active serpins since it exhibits no serine protease inhibitory activity. Aqueous humour level of asymmetric dimethylarginine is correlated with PEDF in humans. PEDF and VEGF structural changes in blood vessel wall play an important role in the pathophysiology of PD patients. PEDF-overexpressing tumors exhibited reduced intratumoral angiogenesis. SerpinF1 is a new promising approach for the treatment of osteosarcoma. Levels of the natural ocular anti-angiogenic factor SentrinF1 (PEDF) is associated with proliferative retinopathy. PEDF blocks angiogenic effects of leptin through its anti-oxidative properties.
Source: HEK 293.
Purity: Greater than 95% as determined by SDS-PAGE.
Amino Acid Sequence: QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVS NFGYDLYRVR SSTSP TTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAP QKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQE INNWVQ AQ MKGKLARSTKEI PDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVP M MSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDID RELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKL TQV EHR AGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTG ALLFIGKILDP R GPA AADYKDDDDK.
Formulation: The sterile filtered concentrated (0.5mg/ml) protein solution was lyophilized with 20mM Tris & 20mM NaCl pH-7.5.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility: Add Add deionized water to a working concentration of 0.5mg/ml and let the lyophilized pellet dissolve completely.
Storage: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°Cfor a limited period of time.
Gene Name: SERPINF1 serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 [ Homo sapiens ]
Synonyms: SERPINF1; serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; PEDF; EPC-1; PIG35; SERPINF1; pigment epithelium-derived factor; serpin F1; serpin-F1; proliferation-inducing protein 35; cell proliferation-inducing gene 35 protein; serpin (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; pigment epithelium-derived factor; proliferation-inducing protein 35
Gene ID: 5176
mRNA Refseq: NM_ 002615
Protein Refseq: NP_ 002606
MIM: 172860
UniProt ID: P36955
Chromosome Location: 17p13.1
Function: serine-type endopeptidase inhibitor activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.