Recombinant Borrelia ospA therapeutic protein(Lyme disease vaccine (recombinant OspA))
Cat.No. : | ospA-P045H |
Product Overview : | Vaccine against Lyme disease that contains lipoprotein OspA, an outer surface protein of Borrelia burgdorferi, as expressed by Escherichia coli. Lipoprotein OspA is a single polypeptide chain of 257 amino acids with lipids covalently bonded to the N terminus. It is conjugated with alum (aluminum hydroxide) as an adjuvant. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia |
Source : | E.coli |
Tag : | Non |
Protein Length : | 257aa |
Description : | Our expression product is the active ingredient of LYMErix. |
Molecular Mass : | 27.7 Kda |
AA Sequence : | MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDVPGGMKVLVSKEKNKDGKYDLMATVDNVDLKGTSDKNN GSGILEGVKADKSKVKLTVADDLSKTTLEVLKEDGTVVSRKVTSKDKSTTEAKFNEKGELSEKTMTRANGT TLEYSQMTNEDNAAKAVETLKNGIKFEGNLASGKTAVEIKEGTVTLKREIDKNGKVTVSLNDTASGSKKTA SWQESTSTLTISANSKKTKDLVFLTNGTITVQNYDSAGTKLEGSAAEIKKLDELKNALR |
Purity : | >95% |
◆ Recombinant Proteins | ||
ospA-4451B | Recombinant Borrelia burgdorferi ospA protein, His-tagged | +Inquiry |
OspA-07B | Recombinant B. burgdorferi OspA Protein, MBP-tagged | +Inquiry |
ospA-14B | Recombinant Borrelia Burgdorferi ospA protein, His-tagged | +Inquiry |
ospA-4222B | Recombinant Borrelia burgdorferi ospA protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ospA Products
Required fields are marked with *
My Review for All ospA Products
Required fields are marked with *