Recombinant Cynomolgus GLP1R Protein, His-tagged
Cat.No. : | GLP1R-549C |
Product Overview : | Recombinant Cynomolgus GLP1R Protein (24-144 aa) with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-144 aa |
Description : | This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
AASequence : | MRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERNSPEEQLLSL |
Endotoxin : | < 1 EU/μg of protein determined by LAL method |
Purity : | > 90% by SDS-PAGE |
Storage Buffer : | PBS buffer, pH 7.4 |
Publications : |
Cochinchinenin C, a potential nonpolypeptide anti-diabetic drug, targets a glucagon-like peptide-1 receptor. (2017)
|
Gene Name | GLP1R glucagon like peptide 1 receptor [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | GLP1R |
Synonyms | GLP1R; glucagon like peptide 1 receptor; glucagon-like peptide 1 receptor |
Gene ID | 719548 |
mRNA Refseq | XM_028847603 |
Protein Refseq | XP_028703436 |
UniProt ID | G7MP82 |
◆ Recombinant Proteins | ||
GLP1R-22H | Recombinant Human GLP1R Protein, Biotinylated | +Inquiry |
GLP1R-01D | Recombinant Dog GLP1R Protein, His-tagged | +Inquiry |
Glp1r-2223R | Recombinant Rat Glp1r protein, His-tagged | +Inquiry |
GLP1R-2565R | Recombinant Rat Glp1r protein, His/SUMO-tagged | +Inquiry |
GLP1R-2755H | Recombinant Human GLP1R Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GLP1R-549C | Recombinant Cynomolgus GLP1R Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLP1R Products
Required fields are marked with *
My Review for All GLP1R Products
Required fields are marked with *