Recombinant Cynomolgus GLP1R Protein, His-tagged

• Cat.No.: GLP1R-549C
• Product Overview: Recombinant Cynomolgus GLP1R Protein (24-144 aa) with His tag was expressed in HEK293.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: His
• Protein Length: 24-144 aa
• Description: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
• AASequence: MRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERNSPEEQLLSL
• Endotoxin: < 1 EU/μg of protein determined by LAL method
• Purity: > 90% by SDS-PAGE
• Storage Buffer: PBS buffer, pH 7.4
• Publications:
  Cochinchinenin C, a potential nonpolypeptide anti-diabetic drug, targets a glucagon-like peptide-1 receptor. (2017)

Gene Information

• Gene Name: GLP1R glucagon like peptide 1 receptor [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: GLP1R
• Synonyms: GLP1R; glucagon like peptide 1 receptor; glucagon-like peptide 1 receptor
• Gene ID: 719548
• mRNA Refseq: XM_028847603
• Protein Refseq: XP_028703436
• UniProt ID: G7MP82