Recombinant Full Length Arabidopsis Thaliana 4-Hydroxybenzoate Polyprenyltransferase, Mitochondrial(Ppt1) Protein, His-Tagged
Cat.No. : | RFL17383AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana 4-hydroxybenzoate polyprenyltransferase, mitochondrial(PPT1) Protein (Q93YP7) (22-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-407) |
Form : | Lyophilized powder |
AA Sequence : | PSSSSALLQSQHKSLSNPVTTHYTNPFTKCYPSWNDNYQVWSKGRELHQEKFFGVGWNYR LICGMSSSSSVLEGKPKKDDKEKSDGVVVKEASWIDLYLPEEVRGYAKLARLDKPIGTWL LAWPCMWSIALAADPGSLPSFKYMALFGCGALLLRGAGCTINDLLDQDIDTKVDRTKLRP IASGLLTPFQGIGFLGLQLLLGLGILLQLNNYSRVLGASSLLLVFSYPLMKRFTFWPQAF LGLTINWGALLGWTAVKGSIAPSIVLPLYLSGVCWTLVYDTIYAHQDKEDDVKVGVKSTA LRFGDNTKLWLTGFGTASIGFLALSGFSADLGWQYYASLAAASGQLGWQIGTADLSSGAD CSRKFVSNKWFGAIIFSGVVLGRSFQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PPT1 |
Synonyms | PPT1; At4g23660; F9D16.130; 4-hydroxybenzoate polyprenyltransferase, mitochondrial; 4-HB polyprenyltransferase; 4HPT; 4-hydroxybenzoate nonaprenyltransferase; Para-hydroxybenzoate--polyprenyltransferase; PHB:PPT; PHB:polyprenyltransferase; Polyprenyltrans |
UniProt ID | Q93YP7 |
◆ Recombinant Proteins | ||
PPT1-3581R | Recombinant Rhesus monkey PPT1 Protein, His-tagged | +Inquiry |
PPT1-29543TH | Recombinant Full Length Human PPT1 Protein, GST-tagged | +Inquiry |
PPT1-13281M | Recombinant Mouse PPT1 Protein | +Inquiry |
Ppt1-574M | Recombinant Mouse Ppt1 protein, His-tagged | +Inquiry |
PPT1-4306R | Recombinant Rat PPT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPT1-001HCL | Recombinant Human PPT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPT1 Products
Required fields are marked with *
My Review for All PPT1 Products
Required fields are marked with *
0
Inquiry Basket