Recombinant Full Length Arabidopsis Thaliana Secretory Carrier-Associated Membrane Protein 1(Scamp1) Protein, His-Tagged
Cat.No. : | RFL27390AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Secretory carrier-associated membrane protein 1(SCAMP1) Protein (Q9SKT3) (1-282aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-282) |
Form : | Lyophilized powder |
AA Sequence : | MSRYQSHSFDDGEINPFANPTSVPAATSKLSPLPPEPYDRGATMDIPLDSGKDLKAKEKE LREKEAELKRREQEIKRKEDAIAQAGIVIEEKNWPPFFPLIHHDISNEIPIHLQRIQYVA FTSMLGLVVCLLWNIVAVTTAWIKGEGPTIWFLAIIYFISGVPGAYVMWYRPLYRAMRTD SALKFGWFFFTYLFHIAFCVFAAVAPPIIFKGKSLTGILPAIDVLSGNILVGIFYFIGFG FFCLESLVSIWVIQQVYMYFRGSGKAAEMKQEATRRAMMAAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SCAMP1 |
Synonyms | SCAMP1; SC1; At2g20840; F5H14.19; Secretory carrier-associated membrane protein 1; AtSC1; Secretory carrier membrane protein 1 |
UniProt ID | Q9SKT3 |
◆ Recombinant Proteins | ||
RFL27390AF | Recombinant Full Length Arabidopsis Thaliana Secretory Carrier-Associated Membrane Protein 1(Scamp1) Protein, His-Tagged | +Inquiry |
Scamp1-347M | Recombinant Mouse Scamp1 Protein, MYC/DDK-tagged | +Inquiry |
SCAMP1-5239R | Recombinant Rat SCAMP1 Protein | +Inquiry |
SCAMP1-11715Z | Recombinant Zebrafish SCAMP1 | +Inquiry |
RFL26015RF | Recombinant Full Length Rat Secretory Carrier-Associated Membrane Protein 1(Scamp1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCAMP1-2050HCL | Recombinant Human SCAMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCAMP1 Products
Required fields are marked with *
My Review for All SCAMP1 Products
Required fields are marked with *
0
Inquiry Basket