Recombinant Full Length Bovine Potassium Voltage-Gated Channel Subfamily V Member 1(Kcnv1) Protein, His-Tagged
Cat.No. : | RFL12720BF |
Product Overview : | Recombinant Full Length Bovine Potassium voltage-gated channel subfamily V member 1(KCNV1) Protein (Q0P583) (1-503aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-503) |
Form : | Lyophilized powder |
AA Sequence : | MELLPPRGRAPPDSSLDSASLTSLDSSVFCSEGEGEPLALGDSFTVNVGGSRFVLSQQAL SCFPHTRLGKLAVVVASCRRRGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYY RTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQ HESEQDFSQGRCPTIRQKLWNILEKPGSCTAARIFGVISIIFVAVSIVNMALMSAELSWL DPQLLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSG SQTTQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGI SIFSTVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGI LVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIM EMLRLKGRERASTRSSGGDDFWF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNV1 |
Synonyms | KCNV1; Potassium voltage-gated channel subfamily V member 1; Voltage-gated potassium channel subunit Kv8.1 |
UniProt ID | Q0P583 |
◆ Recombinant Proteins | ||
KCNV1-385C | Recombinant Cynomolgus Monkey KCNV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNV1-639C | Recombinant Cynomolgus KCNV1 Protein, His-tagged | +Inquiry |
RFL17983RF | Recombinant Full Length Rat Potassium Voltage-Gated Channel Subfamily V Member 1(Kcnv1) Protein, His-Tagged | +Inquiry |
KCNV1-8556M | Recombinant Mouse KCNV1 Protein | +Inquiry |
KCNV1-2885R | Recombinant Rat KCNV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNV1 Products
Required fields are marked with *
My Review for All KCNV1 Products
Required fields are marked with *
0
Inquiry Basket