Recombinant Full Length Danio Rerio Erlin-2(Erlin2) Protein, His-Tagged
Cat.No. : | RFL9088DF |
Product Overview : | Recombinant Full Length Danio rerio Erlin-2(erlin2) Protein (A3QK16) (1-331aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-331) |
Form : | Lyophilized powder |
AA Sequence : | MTLGAVASLILAIGGAAVFSALHKIEEGHVGVYYRGGALLTATSGPGFHLMLPFITTFKSVQTTLQTDEVKNVPCGTGGGVMIYFDRIEVVNYLVPSAVYGIVRNFTADYDKALIFNKVHHELNQFCSVHTLQDVYIGLFDQIDENLKLTLQEDLTSMAPGLIIQAVRVTKPNIPESIRRNYELMESERTKLLIAAQTQKVVEKEAETERKKAVIEAEKVAQVAEIKFGQKVMEKETEKKISQIEDSAYLARQKAKADAEFYSAQRAAEANKLKLTPEYLQLMKFKAIAANSKIYFGSEIPHMFMDSGPGSSSSAASKAIDVLSEGMLDLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | erlin2 |
Synonyms | erlin2; si:dkey-204l11.2; Erlin-2; Endoplasmic reticulum lipid raft-associated protein 2 |
UniProt ID | A3QK16 |
◆ Recombinant Proteins | ||
ERLIN2-2598H | Recombinant Human ERLIN2 Protein (Pro47-Asn339), N-His tagged | +Inquiry |
ERLIN2-3479H | Recombinant Human ERLIN2 Protein, GST-tagged | +Inquiry |
ERLIN2-2140R | Recombinant Rat ERLIN2 Protein | +Inquiry |
RFL9088DF | Recombinant Full Length Danio Rerio Erlin-2(Erlin2) Protein, His-Tagged | +Inquiry |
ERLIN2-2854M | Recombinant Mouse ERLIN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERLIN2-6550HCL | Recombinant Human ERLIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All erlin2 Products
Required fields are marked with *
My Review for All erlin2 Products
Required fields are marked with *
0
Inquiry Basket