Recombinant Full Length Danio Rerio Trimeric Intracellular Cation Channel Type B(Tmem38B) Protein, His-Tagged
Cat.No. : | RFL32472DF |
Product Overview : | Recombinant Full Length Danio rerio Trimeric intracellular cation channel type B(tmem38b) Protein (Q7ZVP8) (1-289aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-289) |
Form : | Lyophilized powder |
AA Sequence : | MDVFAFFNLNELAFGLSKLPMFPYFDMAHYIISVMSLREQPGALCVSQRSPLACWFSSML YCFGGAVLSALMLADAPVAPLSNTTNLLLATLMWYLVFYCPLDVVYSLASLLPLRLVLTA MKEVTRTWKVLSGVSQAGSKYSDALFVMVAVGWAKGAGGGLISNFEQLVRGVWKPETNEL LKMSYPTKVTLLGAVVFSLQQCRYLPIQTHHLTFIYTLFTVTNKTRMMLLGSSSHPLSSL ESFLYKTLFVRPLTDLSAEHTHSKHNGSVPEPTTAQTHTKEAEASKKTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem38b |
Synonyms | tmem38b; zgc:55815; Trimeric intracellular cation channel type B; TRIC-B; TRICB; Transmembrane protein 38B |
UniProt ID | Q7ZVP8 |
◆ Recombinant Proteins | ||
TMEM38B-6166R | Recombinant Rat TMEM38B Protein | +Inquiry |
TMEM38B-4822R | Recombinant Rhesus monkey TMEM38B Protein, His-tagged | +Inquiry |
RFL3685XF | Recombinant Full Length Xenopus Tropicalis Trimeric Intracellular Cation Channel Type B(Tmem38B) Protein, His-Tagged | +Inquiry |
TMEM38B-3287H | Recombinant Human TMEM38B, GST-tagged | +Inquiry |
TMEM38B-4636R | Recombinant Rhesus Macaque TMEM38B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM38B-953HCL | Recombinant Human TMEM38B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All tmem38b Products
Required fields are marked with *
My Review for All tmem38b Products
Required fields are marked with *