Recombinant Full Length Dictyostelium Discoideum Protein Rer1 Homolog(Rer1) Protein, His-Tagged
Cat.No. : | RFL11703DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Protein RER1 homolog(rer1) Protein (Q54D10) (1-188aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-188) |
Form : | Lyophilized powder |
AA Sequence : | MPTTIDEGLPAPHNFVSFTTLIARKYQNLIEKTISFIPQRWAFVGFLSFLYILRVSLSSG GWYVITYALGIFLLTRFIAFLSPKWDPELEEDSGDSLPTTLNRNDDEAKPFIRRLPEFLF WHSIFKALFISIFCTFIPFLDLPVFWPILLLYFIIIFSVTMKKQIKHMIKYKYIPFTVGK KTYTKNNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rer1 |
Synonyms | rer1; DDB_G0292588; Protein RER1 homolog |
UniProt ID | Q54D10 |
◆ Recombinant Proteins | ||
Rer1-5464M | Recombinant Mouse Rer1 Protein, Myc/DDK-tagged | +Inquiry |
RER1-4997R | Recombinant Rat RER1 Protein | +Inquiry |
RFL7469HF | Recombinant Full Length Human Protein Rer1(Rer1) Protein, His-Tagged | +Inquiry |
RER1-10944Z | Recombinant Zebrafish RER1 | +Inquiry |
RER1-4656R | Recombinant Rat RER1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RER1-2419HCL | Recombinant Human RER1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All rer1 Products
Required fields are marked with *
My Review for All rer1 Products
Required fields are marked with *