Recombinant Full Length Human CD164 Protein

Cat.No. : CD164-2987HF
Product Overview : Human CD164 full-length ORF (NP_006007.2) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 92 amino acids
Description : This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sez
Form : Liquid
Molecular Mass : 20.9 kDa
AA Sequence : MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL
Applications : Antibody Production
Functional Study
Compound Screening
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name CD164 CD164 molecule, sialomucin [ Homo sapiens ]
Official Symbol CD164
Synonyms CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn;
Gene ID 8763
mRNA Refseq NM_001142401
Protein Refseq NP_001135873
MIM 603356
UniProt ID Q04900

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD164 Products

Required fields are marked with *

My Review for All CD164 Products

Required fields are marked with *

0
cart-icon