Recombinant Full Length Human CD164 Protein
| Cat.No. : | CD164-2987HF |
| Product Overview : | Human CD164 full-length ORF (NP_006007.2) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 92 amino acids |
| Description : | This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sez |
| Form : | Liquid |
| Molecular Mass : | 20.9 kDa |
| AA Sequence : | MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL |
| Applications : | Antibody Production Functional Study Compound Screening |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | CD164 CD164 molecule, sialomucin [ Homo sapiens ] |
| Official Symbol | CD164 |
| Synonyms | CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn; |
| Gene ID | 8763 |
| mRNA Refseq | NM_001142401 |
| Protein Refseq | NP_001135873 |
| MIM | 603356 |
| UniProt ID | Q04900 |
| ◆ Recombinant Proteins | ||
| CD164-0728H | Recombinant Human CD164 Protein, GST-Tagged | +Inquiry |
| CD164-151H | Recombinant Human CD164 Protein, His-tagged | +Inquiry |
| CD164-3931Z | Recombinant Zebrafish CD164 | +Inquiry |
| CD164-30H | Recombinant Human CD164 protein, T7/His-tagged | +Inquiry |
| CD164-2078HFL | Recombinant Full Length Human CD164 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD164-1257RCL | Recombinant Rat CD164 cell lysate | +Inquiry |
| CD164-1932HCL | Recombinant Human CD164 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD164 Products
Required fields are marked with *
My Review for All CD164 Products
Required fields are marked with *
