Recombinant Full Length Human CD5L Protein
Cat.No. : | CD5L-76HF |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-347 of Human CD5L, with an N-terminal proprietary tag, predicted MWt 64.24 kDa |
- Specification
- Gene Information
- Related Products
- Download
Description : | CD5 antigen-like is a protein that in humans is encoded by the CD5L gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 64.240kDa inclusive of tags |
Protein length : | 347 amino acids |
AA Sequence : | MALLFSLILAICTRPGFLASPSGVRLVGGLHRCEGRVEVE QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYE PPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDA GASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWY TVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKP IWLSQMSCSGREATLQDCPSGPWGKNTCNHDEDTWVECED PFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQV VCKQLGCGKSLSPSFRDRKCYGPGVGRIWLDNVRCSGEEQ SLEQCQHRFWGFHDCTHQEDVAVICSG |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CD5L CD5 molecule-like [ Homo sapiens ] |
Official Symbol : | CD5L |
Synonyms : | CD5L; CD5 molecule-like; API6, apoptosis inhibitor 6 , CD5 antigen like (scavenger receptor cysteine rich family); CD5 antigen-like; Spalpha |
Gene ID : | 922 |
mRNA Refseq : | NM_005894 |
Protein Refseq : | NP_005885 |
MIM : | 602592 |
UniProt ID : | O43866 |
Products Types
◆ Recombinant Protein | ||
CD5L-2635H | Recombinant Human CD5L Protein, His (Fc)-Avi-tagged | +Inquiry |
CD5L-3185H | Recombinant Full Length Human CD5L protein(Met1-Gly347), His-tagged | +Inquiry |
CD5L-3115H | Recombinant Human CD5L Protein, MYC/DDK-tagged | +Inquiry |
CD5L-0837H | Recombinant Human CD5L Protein, GST-Tagged | +Inquiry |
Cd5l-629M | Recombinant Mouse Cd5l Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
CD5L-3042MCL | Recombinant Mouse CD5L cell lysate | +Inquiry |
CD5L-2302HCL | Recombinant Human CD5L cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CD5L Products
Required fields are marked with *
My Review for All CD5L Products
Required fields are marked with *
0
Inquiry Basket