Recombinant Full Length Human CD5L Protein

Cat.No. : CD5L-76HF
Product Overview : Recombinant full length protein, corresponding to amino acids 1-347 of Human CD5L, with an N-terminal proprietary tag, predicted MWt 64.24 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CD5 antigen-like is a protein that in humans is encoded by the CD5L gene.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 64.240kDa inclusive of tags
Protein Length : 347 amino acids
AA Sequence : MALLFSLILAICTRPGFLASPSGVRLVGGLHRCEGRVEVE QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYE PPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDA GASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWY TVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKP IWLSQMSCSGREATLQDCPSGPWGKNTCNHDEDTWVECED PFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQV VCKQLGCGKSLSPSFRDRKCYGPGVGRIWLDNVRCSGEEQ SLEQCQHRFWGFHDCTHQEDVAVICSG
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : CD5L CD5 molecule-like [ Homo sapiens ]
Official Symbol : CD5L
Synonyms : CD5L; CD5 molecule-like; API6, apoptosis inhibitor 6 , CD5 antigen like (scavenger receptor cysteine rich family); CD5 antigen-like; Spalpha
Gene ID : 922
mRNA Refseq : NM_005894
Protein Refseq : NP_005885
MIM : 602592
UniProt ID : O43866

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD5L Products

Required fields are marked with *

My Review for All CD5L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends