Recombinant Full Length Human CFDP1 Protein, GST-tagged

Cat.No. : CFDP1-3294HF
Product Overview : Human CFDP1 full-length ORF (NP_006315.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 299 amino acids
Description : CFDP1 (Craniofacial Development Protein 1) is a Protein Coding gene.
Molecular Mass : 60 kDa
AA Sequence : MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CFDP1 craniofacial development protein 1 [ Homo sapiens ]
Official Symbol CFDP1
Synonyms CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR;
Gene ID 10428
mRNA Refseq NM_006324
Protein Refseq NP_006315
MIM 608108
UniProt ID Q9UEE9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFDP1 Products

Required fields are marked with *

My Review for All CFDP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon