Recombinant Full Length Human CFL1 Protein, C-Flag-tagged
Cat.No. : | CFL1-1692HFL |
Product Overview : | Recombinant Full Length Human CFL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 18.3 kDa |
AA Sequence : | MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY EEVKDRCTLAEKLGGSAVISLEGKPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | CFL1 cofilin 1 [ Homo sapiens (human) ] |
Official Symbol | CFL1 |
Synonyms | CFL; cofilin; HEL-S-15 |
Gene ID | 1072 |
mRNA Refseq | NM_005507.3 |
Protein Refseq | NP_005498.1 |
MIM | 601442 |
UniProt ID | P23528 |
◆ Recombinant Proteins | ||
CFL1-1172H | Recombinant Human CFL1 Protein, GST-Tagged | +Inquiry |
CFL1-1356R | Recombinant Rat CFL1 Protein | +Inquiry |
CFL1-26844TH | Recombinant Human CFL1, His-tagged | +Inquiry |
CFL1-828R | Recombinant Rhesus monkey CFL1 Protein, His-tagged | +Inquiry |
CFL1-3296HF | Recombinant Full Length Human CFL1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFL1-7555HCL | Recombinant Human CFL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFL1 Products
Required fields are marked with *
My Review for All CFL1 Products
Required fields are marked with *
0
Inquiry Basket