Recombinant Full Length Human CHAC1 Protein, GST-tagged
Cat.No. : | CHAC1-3306HF |
Product Overview : | Human CHAC1 full-length ORF (NP_077016.1, 1 a.a. - 222 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 222 amino acids |
Description : | This gene encodes a member of the gamma-glutamylcyclotransferase family of proteins. The encoded protein has been shown to promote neuronal differentiation by deglycination of the Notch receptor, which prevents receptor maturation and inhibits Notch signaling. This protein may also play a role in the unfolded protein response, and in regulation of glutathione levels and oxidative balance in the cell. Elevated expression of this gene may indicate increased risk of cancer recurrence among breast and ovarian cancer patients. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 50.8 kDa |
AA Sequence : | MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHAC1 ChaC glutathione specific gamma-glutamylcyclotransferase 1 [ Homo sapiens (human) ] |
Official Symbol | CHAC1 |
Synonyms | CHAC1; ChaC glutathione specific gamma-glutamylcyclotransferase 1; ChaC Glutathione Specific Gamma-Glutamylcyclotransferase 1; Gamma-GCT Acting On Glutathione Homolog 1; Blocks Notch Protein; Gamma-GCG 1; Botch; Glutathione-Specific Gamma-Glutamylcyclotransferase 1; ChaC, Cation Transport Regulator Homolog 1 (E. Coli); ChaC, Cation Transport Regulator Homolog 1; Cation Transport Regulator-Like Protein 1; ChaC, Cation Transport Regulator-Like 1; EC 2.3.2.- |
Gene ID | 79094 |
mRNA Refseq | NM_024111 |
Protein Refseq | NP_077016 |
MIM | 614587 |
UniProt ID | Q9BUX1 |
◆ Recombinant Proteins | ||
CHAC1-181HCL | Recombinant Human CHAC1 Over-expression Lysate | +Inquiry |
CHAC1-4446C | Recombinant Chicken CHAC1 | +Inquiry |
CHAC1-1361R | Recombinant Rat CHAC1 Protein | +Inquiry |
CHAC1-1199H | Recombinant Human CHAC1 Protein, GST-Tagged | +Inquiry |
CHAC1-5990H | Recombinant Human CHAC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHAC1 Products
Required fields are marked with *
My Review for All CHAC1 Products
Required fields are marked with *