Recombinant Full Length Human CHAC2 Protein, C-Flag-tagged
Cat.No. : | CHAC2-1084HFL |
Product Overview : | Recombinant Full Length Human CHAC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.7 kDa |
AA Sequence : | MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVG KEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGR NTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CHAC2 ChaC glutathione specific gamma-glutamylcyclotransferase 2 [ Homo sapiens (human) ] |
Official Symbol | CHAC2 |
Synonyms | GCG1 |
Gene ID | 494143 |
mRNA Refseq | NM_001008708.4 |
Protein Refseq | NP_001008708.1 |
MIM | 617446 |
UniProt ID | Q8WUX2 |
◆ Recombinant Proteins | ||
CHAC2-2028H | Recombinant Human CHAC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CHAC2-415H | Recombinant Human ChaC, cation transport regulator homolog 2 (E. coli), His-tagged | +Inquiry |
CHAC2-1084HFL | Recombinant Full Length Human CHAC2 Protein, C-Flag-tagged | +Inquiry |
Chac2-2135M | Recombinant Mouse Chac2 Protein, Myc/DDK-tagged | +Inquiry |
CHAC2-835R | Recombinant Rhesus monkey CHAC2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHAC2-344HCL | Recombinant Human CHAC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHAC2 Products
Required fields are marked with *
My Review for All CHAC2 Products
Required fields are marked with *
0
Inquiry Basket