Recombinant Full Length Human CHCHD6 Protein, C-Flag-tagged
| Cat.No. : | CHCHD6-2102HFL | 
| Product Overview : | Recombinant Full Length Human CHCHD6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Mammalian Cells | 
| Tag : | Flag | 
| Description : | Involved in cellular response to DNA damage stimulus and cristae formation. Located in cytosol and mitochondrial inner membrane. Part of MICOS complex. | 
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
| Molecular Mass : | 26.3 kDa | 
| AA Sequence : | MGSTESSEGRRVSFGVDEEERVRVLQGVRLSENVVNRMKEPSSPPPAPTSSTFGLQDGNLRAPHKESTLP RSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKASLPTGEGSISHEEQKSVRLARE LESREAELRRRDTFYKEQLERIERKNAEMYKLSSEQFHEAASKMESTIKPRRVEPVCSGLQAQILHCYRD RPHEVLLCSDLVKAYQRCVSAAHKG myc-FLAG tag | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80 centigrade. | 
| Concentration : | >50 ug/mL as determined by microplate BCA method. | 
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Full Length : | Full L. | 
| Gene Name | CHCHD6 coiled-coil-helix-coiled-coil-helix domain containing 6 [ Homo sapiens (human) ] | 
| Official Symbol | CHCHD6 | 
| Synonyms | CHCM1; Mic25; MICOS25; PPP1R23 | 
| Gene ID | 84303 | 
| mRNA Refseq | NM_032343.3 | 
| Protein Refseq | NP_115719.1 | 
| MIM | 615634 | 
| UniProt ID | Q9BRQ6 | 
| ◆ Recombinant Proteins | ||
| Chchd6-2140M | Recombinant Mouse Chchd6 Protein, Myc/DDK-tagged | +Inquiry | 
| CHCHD6-840R | Recombinant Rhesus monkey CHCHD6 Protein, His-tagged | +Inquiry | 
| CHCHD6-6696H | Recombinant Human CHCHD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| CHCHD6-666R | Recombinant Rhesus Macaque CHCHD6 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CHCHD6-2102HFL | Recombinant Full Length Human CHCHD6 Protein, C-Flag-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CHCHD6-7543HCL | Recombinant Human CHCHD6 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHCHD6 Products
Required fields are marked with *
My Review for All CHCHD6 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            