Recombinant Full Length Human CLN5 Protein, C-Flag-tagged
Cat.No. : | CLN5-1517HFL |
Product Overview : | Recombinant Full Length Human CLN5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MRRNLRLGPSSGADAQGQGAPRPGLAAPRMLLPPASQASRGSGSTGCSLMAQEVDTAQGAEMRRGAGAAR GRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDD IEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQ GAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDC SKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPT KEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Lysosome |
Full Length : | Full L. |
Gene Name | CLN5 CLN5 intracellular trafficking protein [ Homo sapiens (human) ] |
Official Symbol | CLN5 |
Synonyms | NCL |
Gene ID | 1203 |
mRNA Refseq | NM_006493.4 |
Protein Refseq | NP_006484.2 |
MIM | 608102 |
UniProt ID | O75503 |
◆ Recombinant Proteins | ||
CLN5-1506H | Recombinant Human CLN5 Protein, GST-tagged | +Inquiry |
CLN5-1517HFL | Recombinant Full Length Human CLN5 Protein, C-Flag-tagged | +Inquiry |
CLN5-5438C | Recombinant Chicken CLN5 | +Inquiry |
CLN5-619H | Recombinant Human CLN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLN5-4533H | Recombinant Human CLN5 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLN5-7439HCL | Recombinant Human CLN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLN5 Products
Required fields are marked with *
My Review for All CLN5 Products
Required fields are marked with *
0
Inquiry Basket