Recombinant Full Length Human complexin 2 Protein, Flag tagged

Cat.No. : CPLX2-23HFL
Product Overview : Recombinant protein of human complexin 2 (CPLX2), transcript variant 2 with C-Myc/DDK tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Protein Length : 1-134aa
Description : Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.
Tag : C-Flag
Molecular Mass : 15.2 kDa
AA Sequence : MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : > 0.05 μg/μL as determined by microplate BCA method
Storage Buffer : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Gene Name CPLX2 complexin 2 [ Homo sapiens (human) ]
Official Symbol CPLX2
Synonyms CPLX2; complexin 2; complexin-2; CPX 2; DKFZp547D155; CPX II; synaphin 1; synaphin-1; complexin II; CPX2; Hfb1; 921-L; CPX-2; MGC138492;
Gene ID 10814
mRNA Refseq NM_001008220
Protein Refseq NP_001008221
MIM 605033
UniProt ID Q6PUV4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CPLX2 Products

Required fields are marked with *

My Review for All CPLX2 Products

Required fields are marked with *

0
cart-icon
0
compare icon