Recombinant Full Length Human complexin 2 Protein, Flag tagged

• Cat.No.: CPLX2-23HFL
• Product Overview: Recombinant protein of human complexin 2 (CPLX2), transcript variant 2 with C-Myc/DDK tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Protein Length: 1-134aa
• Description: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.
• Tag: C-Flag
• Molecular Mass: 15.2 kDa
• AA Sequence: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: > 0.05 μg/μL as determined by microplate BCA method
• Storage Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.

Gene Information

• Gene Name: CPLX2 complexin 2 [ Homo sapiens (human) ]
• Official Symbol: CPLX2
• Synonyms: CPLX2; complexin 2; complexin-2; CPX 2; DKFZp547D155; CPX II; synaphin 1; synaphin-1; complexin II; CPX2; Hfb1; 921-L; CPX-2; MGC138492
• Gene ID: 10814
• mRNA Refseq: NM_001008220
• Protein Refseq: NP_001008221
• MIM: 605033
• UniProt ID: Q6PUV4